SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007778 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007778
Domain Number 1 Region: 714-837
Classification Level Classification E-value
Superfamily TNF-like 1.18e-19
Family TNF-like 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000007778
Domain Number - Region: 115-254
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00523
Family BAR domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007778   Gene: ENSMEUG00000008491   Transcript: ENSMEUT00000008533
Sequence length 838
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8152:7252:24053:-1 gene:ENSMEUG00000008491 transcript:ENSMEUT00000008533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NWCPYRQSRLVTFVASCKTEKFLVHSQQPCPPGTSDCQKVKVMSRISLKPIYQVKQKVLI
SVVWKCCPGYSGADCQHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFSRETMEFGEQEQ
HETLLEDLQNDIHQATSNLLDLQKSLESNHTAKEMEANLTRFGSSDQSLQQILLSHVESF
LKNHFSPIWRSFNESLHNLSHVVRNLSHDVEANRQNIERFQEIAVPKEEFQELGTKFESK
VQENILKVNQLRQDIDSQLRDQQLVLNHNLSTVRADTDLKVKKIQKAQEVTYYLIPAAET
KEEQDDLQVKLGQLQSNLSELSFASARREDEVLSALRQLNETLARHEEDIKELFMDSDEN
FELGTRLEGQVSTMLSNKAMIEELRVILMEKSLIMEEIKEDFERQILDLNYTLHHLQGSH
SDLMKYVKDCNCQKLYFDLSLLREDQRNATRFLEETHVTLEDQKMLESSSIKALRNAVED
IALSVDAQKEEITQAKESVALFKGQLQALVGEVEGLKRVDRHVFREIRHLNHSFGSLLED
ALRHQIVLATLFGEEMLEEITEEENDKLPLTYLQIEDALDYTSNRLKEHAIDLMALEHLE
PNHEQMGAAPNDLASLKSEVTHLGTQVEKRPRATARGAAIPLNSSVEGLQSDVRAMKQDL
GHHLQLFHNLFGNYQELLATNISLDLRKLQSVLSKKGKKQKREQESPWEWEKSSVAFYAG
FPQGTHGLRRPVKFNATYLNIGDGYSSEHGFFRAPERGVYLIAVSAEFGPGLGEGQLVLG
GRLRTSVSSAPRSGSTAATFALTELQKGERVWFELTKGSLARRDPSGTALGGFLVFKT
Download sequence
Identical sequences ENSMEUP00000007778 ENSMEUP00000007778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]