SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007872 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007872
Domain Number 1 Region: 261-496
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-74
Family Nuclear receptor ligand-binding domain 0.00000000319
Further Details:      
 
Domain Number 2 Region: 168-197
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000173
Family Nuclear receptor 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000007872
Domain Number - Region: 141-180
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0248
Family Hydrophobin II, HfbII 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007872   Gene: ENSMEUG00000008618   Transcript: ENSMEUT00000008639
Sequence length 502
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9814:85701:91852:-1 gene:ENSMEUG00000008618 transcript:ENSMEUT00000008639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RERGAKHCGAGTRWWRRRVEVAAGEQQAPEPEPGGAGRDGMGDSGRDCRSPDSSSLNPLP
GGGPPPSPPGPPLAPLPSATSSLLGTGGPPQLPLGSPFPVISSSMGSPGLPPPAPPGPYG
PVSSPQINSTVSLPGGGSGPPEDVKPPLLGVRGLHCPPPPAGPGAGKRLCAICGDRSSGK
HYGVYSCEGCKGFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
QEERQRGKEKDGEGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGGGSSPNDP
VTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSISVRDGI
LLATGLHVHRNSAHSAGVGAIFDRLFHRVLTELVSKMRDMRMDKTELGCLRAIILFNPDA
KGLSNPGEVEILREKVYASLESYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFK
LIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences ENSMEUP00000007872 ENSMEUP00000007872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]