SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007923 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000007923
Domain Number - Region: 290-425
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.09
Family IMD domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007923   Gene: ENSMEUG00000008677   Transcript: ENSMEUT00000008695
Sequence length 456
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_556:5:61256:-1 gene:ENSMEUG00000008677 transcript:ENSMEUT00000008695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGSDTALTVDRTYSDPGRHQRCRSRVERHDMNTLSLPLNIRRGGSDTNLNLDVPDGILD
FHKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSLEEFRPEASSRAYG
GSATIVTKPKYGSDDECSSGTSGSADSNGNQSFGTGGTNTLSSQGKLAMILEELREIKET
QAQLAEDIESLKGQFKREYSFISQTLQEERYRYERLEDQLHDLTDLHQHETTNLKQELAS
IEEKVAYQAYERSRDVQEALESCQTRISKLELHQQEQQALQTDTVNAKVLLGKCINVILA
FMTVILVCVSTIAKFVAPMMKSRFHILGTFFAVTLL
Download sequence
Identical sequences ENSMEUP00000007923 ENSMEUP00000007923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]