SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008076 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008076
Domain Number 1 Region: 314-443
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000295
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000008076
Domain Number - Region: 39-84
Classification Level Classification E-value
Superfamily HR1 repeat 0.00254
Family HR1 repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008076   Gene: ENSMEUG00000008830   Transcript: ENSMEUT00000008862
Sequence length 565
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_66:24491:38882:-1 gene:ENSMEUG00000008830 transcript:ENSMEUT00000008862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFCDTPEDTELQRKLDHEIRMREGACKLLA
ACSQREQALEATKSLLVCSSRILSYMGELQRRKEAQVLGKTARRPSDTGPPNERSPCRGT
ICISDIRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGGNIQDTEMVLVDRTLTDISFQSSV
LFTEAGPDFELRLELYGACVEEEGALAGAPRRLATKLSNSLGRSSGRRVRASLDSAGGSG
NSSVVSPILLPTPAVGGPRYHLLAQTTLTLAAVQDGFRTHDLTLTSNEESPAWLPLYGSV
CCRLAAQPLCMTQPVMSGTLRVQHPGLQSWGQVHGIVRGTNLFCYRHPGEADTQDDPLFT
IAINKXXXXXXXXXXXXXXXXXTLIISRYGGDEVTHTLRMESRGTLQRWMEALWQLFFDM
SQWKQCCDELMKIEAPPPRKPPPVLAKQGSLYHEMAIEPLDDIAAVTDILAKREGPPLDV
PPPWLALFTEKALLQAPSPCTPKPLSTSGLPRLPTWGRPRTLSLDAAPRGRPPSSSSGSG
SPAPQQRSPPARGFGKSRPWLQSPV
Download sequence
Identical sequences ENSMEUP00000008076 ENSMEUP00000008076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]