SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008363 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008363
Domain Number 1 Region: 70-200
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-44
Family C-type lectin domain 0.0000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008363   Gene: ENSMEUG00000009162   Transcript: ENSMEUT00000009182
Sequence length 203
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2041:407:3546:-1 gene:ENSMEUG00000009162 transcript:ENSMEUT00000009182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQNLKEPPAKQIALRSQASQISQQVDRLQEDGTTFRSQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXSVCKNCPKDWNFQKKCYFFGNEPKTWPQAKFACINLQGRLVSIKNKEEQAF
LTQKANKKGSWIGLRDLDMEGEFIWMDGSPLNYSNWSPGEPNNQGQGEDCVAMRANNGRW
NDAFCRGQQEGWICEKLATCPLT
Download sequence
Identical sequences ENSMEUP00000008363 ENSMEUP00000008363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]