SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008413 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008413
Domain Number 1 Region: 688-822
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-42
Family C-type lectin domain 0.00000508
Further Details:      
 
Domain Number 2 Region: 146-261
Classification Level Classification E-value
Superfamily C-type lectin-like 1.47e-41
Family Link domain 0.0058
Further Details:      
 
Domain Number 3 Region: 259-372
Classification Level Classification E-value
Superfamily C-type lectin-like 7.42e-31
Family Link domain 0.0063
Further Details:      
 
Domain Number 4 Region: 41-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000473
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 
Domain Number 5 Region: 816-874
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000132
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 6 Region: 651-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000034
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008413   Gene: ENSMEUG00000009198   Transcript: ENSMEUT00000009238
Sequence length 879
Comment pep:novel scaffold:Meug_1.0:Scaffold12085:7107:25957:1 gene:ENSMEUG00000009198 transcript:ENSMEUT00000009238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQMLLLLLTALVQVLTSSSVAFTGDSSEDQAFKVSIGGDSPLRGVLGGSITIPCHISYL
RPPPSRAVLSPVKWTFLSWGREAEVLVARGLKVKVSEGYRYRVALPGYPASTTDVSLVLS
ELRSNDSGLYRCEVQHGIDDGSDAVEVKVKGVVFLYREGSARYAFSFSRAKEACARIGAR
IASPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGMVDPEDL
YDVYCYAEDLNGELFLGSTPDKLTLEEARAYCWERGAEIATTGQLYAAWDEGLDRCSPGW
LADGSVRYPIVTPRQRCGGGLPGVKTLFLFPNQTGFPNAHSRFNVYCFRDPAQSSVPEES
YPASDGLETIVTVTETLQELQLLQEATQSESRGAIYSVPISEDSRGISSTPEDPEEAPKI
FLEDGDQSVTPPMQSSEEEAEEDEKVIEEEDEEGQEEGEKEKEVEDEAPSPVQSEIREVA
IENGSHSTEPPHEEKLSEAPLVAQVSVHDSAMPSPGEEPEGPRHPRVREQSIETLPTLGI
VTQGEGSQASPPPTTPVSTEEEDEEEVGAPELSGGTPPWVPHGESDEVGSSEEAPGLSPA
TGTLEGAGDRVAPPEESPGRTAPVETSVRAQPALPTESAGLGAVGAAPSPGDCVPSPCHN
GGTCYEEGDGVHCLCLPGYGGNLCEIGLRSCSSGWDAFQGSCYKHFSTRRSWEEAETQCR
LHGAHLTSISTPEEQNFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSY
FLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLALVFGRPRSRYEVD
DVLRYHCREGLAQRNSPMIRCLEDGQWEPPQISCVSKRP
Download sequence
Identical sequences ENSMEUP00000008413 ENSMEUP00000008413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]