SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008655 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008655
Domain Number 1 Region: 563-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.66e-53
Family Ankyrin repeat 0.00000693
Further Details:      
 
Domain Number 2 Region: 441-558
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.62e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00000522
Further Details:      
 
Domain Number 3 Region: 1076-1135
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 219-290
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000000157
Family BAR domain 0.0058
Further Details:      
 
Domain Number 5 Region: 53-87,129-268
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000889
Family BAR domain 0.01
Further Details:      
 
Domain Number 6 Region: 370-418,449-472
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000102
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008655   Gene: ENSMEUG00000009455   Transcript: ENSMEUT00000009514
Sequence length 1136
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6096:3981:154807:-1 gene:ENSMEUG00000009455 transcript:ENSMEUT00000009514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEE
ALTMAFRGEQSTGENSLEDLTRAIIDDIQRLPGNDVCCDCGSSEPTWLSTNLGILTCIEC
SGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNEIMEGNLPSPSPKPTPSSDMT
ARKEYITAKYVDHRFSRKTCLSSSAKLNELLDAIKSRDLLALIQVYAEGVELMEPLLEPG
QEPGETALHVAVRTADQTSLHLVDFLVQXXGNLDKQTALGNTVLHYCSMYNKPECLKLLL
RSKPTVDIANQGGETALDTAKRLKATQCEDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXPSPIKKERSPRPQSFCHSSSMSPQDKLALPGFSTPRDKQRLSYGAFTNQIFAS
TSIESPTSPTADAPPLPPRNAGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXNDMGPSSSSKTTNKFEGMSQQSXXXXXXXXXXXXXXXXX
XXXXALRKIETSHHLSIDKSNVPPEIFQKSPQPLELPQKPQPGDLPPKPQPAELGPKPQI
GDLPPKPGELPPKPQLGDLPPKPQLSDLPPKPQIKDLPPKPQLDLLAKSQAGESSPKTHQ
PPKATPKTHPEDLSPNVQSRETLQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVK
TIYDCQADNDDELTFIEGEVIVVTGEEDHEWWIGHIEGHPERKGVFPVSFVHILSD
Download sequence
Identical sequences ENSMEUP00000008655 ENSMEUP00000008655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]