SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008737 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008737
Domain Number 1 Region: 298-440
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-39
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 194-299
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-37
Family Second domain of FERM 0.00000288
Further Details:      
 
Domain Number 3 Region: 113-193
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-27
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008737   Gene: ENSMEUG00000009566   Transcript: ENSMEUT00000009606
Sequence length 1095
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1143:26259:103303:-1 gene:ENSMEUG00000009566 transcript:ENSMEUT00000009606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKQDQEPEHQEASGQPGQAGAQQQPPEQPLREEHQQALEQFPAAAAHSTP
VKKEVTDKEQEFAAAALKQLEYQQFEDDKLSQKSYSSKLSRSPLKIVKKPKSMQCKVILL
DGTEYLCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDTENQKNWLDPAKEIKKQIRS
GAWQFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSEL
GDYDPDECGSDYVSEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYG
VDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFE
QFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTR
RASALIDRPAPYFERSSSKRYTMSRSLDGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXSPWLGNSSFSSSPSSYNGPTASPATLRRRCKENVQ
KALGCEPAKDTGQTRGEPDLDSNGKGKAYAGDQDLAFSYKQQTCKGATLFSFSLQLPESF
PSLLDDDGYLSFPNLSETNLLPANLQHYLPIRSPSLVPCFLFIFFFLLSASFSMPYALTL
SFPLAMCLCYLEPKAASLSASLDNDPSDSSEEETDSEQTDTAADGETTATESDQEEDADL
KAQELDKNQEELMKHQTNISELKRTFLETSTETAVTNEWEKRLSTSPVRLAMRQEDAPMI
EPLVPEETKPTGEKIMDGSDIFTLIDSARKPTEFIGGVTTSSQKWVQRTETKLEPSEIEK
ESSEQPQQLSAEKVVQQTMVVEERHVMNVHASGDGSNLAGTQLDAAAQAASAVASNITGK
AGTALTEGAKEEKREEAEAEKAEIKQEEIATASHEREEEQTARSLISESLESKPHFESSV
KTETISFGSVSPGGIKLEISTKEVPVVHTETKTITYESSQVDSSADTEPGVLMSAQTITS
ETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHDMSVTKV
VVHKETEITPEDGED
Download sequence
Identical sequences ENSMEUP00000008737 ENSMEUP00000008737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]