SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008839 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008839
Domain Number 1 Region: 97-172
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-27
Family Nuclear receptor 0.0000618
Further Details:      
 
Domain Number 2 Region: 283-369
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-22
Family Nuclear receptor ligand-binding domain 0.00000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008839   Gene: ENSMEUG00000009703   Transcript: ENSMEUT00000009724
Sequence length 369
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_227:1350:15597:1 gene:ENSMEUG00000009703 transcript:ENSMEUT00000009724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPEQSGHLGPDSDVSPYTQYGNIQFSQVQPPISSSPYYPNLGFYPQQPEEWYSPGMYEL
RRVPSETVYTRESETVDIPITKKPRMVSSTGRMKGEELCVVCGDKASGYHYNALTCEGCK
GFFRRSITKNAVYKCKNGGNCEMDMYMRRKCQECRLRKCKQMGMLAECMYTGLLTEIQCK
SKRLRKNMKPPSDRSANEDSEGSDLRQVTSTTKPYREKIELTPDQQNLLYYIMDAYSKQR
MPQEITNKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQTLDHEDQIALLKGSA
VEAMFLRSAEIFSKKLPVGHTDLLEERIRKSGISDEYITPMFNFYKSIGELKMTQEEYAL
LTAIVILSP
Download sequence
Identical sequences ENSMEUP00000008839 ENSMEUP00000008839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]