SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008993 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008993
Domain Number 1 Region: 59-70,125-261
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-21
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Domain Number 2 Region: 367-456
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-21
Family Pleckstrin-homology domain (PH domain) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008993   Gene: ENSMEUG00000009852   Transcript: ENSMEUT00000009888
Sequence length 715
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6404:6190:46843:1 gene:ENSMEUG00000009852 transcript:ENSMEUT00000009888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEISYMYMNTADLHSGPSFVESLFEEFDCALSDLQNMHEEDDRDSLEPATSQLPRKSSDP
PPPLPTNPPPDDDYEEALPLGPGKTPEYISSHXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXNDSDAMSSSYESYDDEEEDGKGQQLTHQWPSEEASMHLVKDCRICAFLLRKKRF
GQWAKQLTLIRDNQLLCYKNSKDHQPHLKLALGVCNVIYMPRDGRRKKHELRFSLGGTET
LVLAVQSREQAEEWLKVIKEVNKSSGGVDGAEEPKSPVLQCKLDLDKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXRSKKSSLAELKGSVSRAAGRKINRIISFSKKKSQTEDTQMS
PAEEGVPCCGYLNVLGNQCWKERWCRLKGNTLFFHKDRTDLRTHVNAIILQGCEVVPGFG
PKHPFAFRILRGRQEVSILEASCSEDMGRWLGLLLAETGSRVPPEALHYDYVDVETIASI
VSAGRQSFLFASSCQGQWPEPRVYDEVPYEKLQNDEPKRPSGAQVKRHASTCSEKSLRVD
PQVKVKRHASSANQYRYGKNRAEEDARKYLVEKEKLETEKGFIRNELMTLRKEKRELKET
LKNSAGTSLKDLEEKLVMLEAQCREKEERRIDLELKLVAVKENLKQSLAGGPALGLTVTN
QRKTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEWEMKKT
Download sequence
Identical sequences ENSMEUP00000008993 ENSMEUP00000008993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]