SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009005 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000009005
Domain Number - Region: 407-493
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00199
Family FCH domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009005   Gene: ENSMEUG00000009875   Transcript: ENSMEUT00000009900
Sequence length 514
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5874:4369:82453:1 gene:ENSMEUG00000009875 transcript:ENSMEUT00000009900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFDSIHKLIEETQIFKLQQSSLRSPCEPTPPGSPLCDPSNSYLPPQGLHSHGTHMVPGN
FYAHSCSSNDWDICEELRVRELEEVKARAAQMEKTMRWWSDCTANWREKWSKVRTERNKA
REEGRQLRIKLDMAMKELSALKKKQSSLNEKETLDAEVIWKEKPGLIEGSCPQEAQFPVA
SEEYGTPRINLGKTQVSLKEDTSKKEIEMVANSVRINQDLDLQGPDFFRKGLSGNCVTKP
VLGLDDVAPPTEKELTQISTLKFHLDESQKILWKERXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLERLQAEN
TSEWGKREILETEKQGLERDNRRLKAQVKEMEELLDKKNPLAATSQVSDLKTSQNELLEK
NKELAELQHAYCKLNKQYQDKMAELIHANNRVDHHEAEVKKLRFRVEDLKKSLNHAEDEL
DGSLNQIRKLQRSLDEQIEINDNLHFQLNHLQSR
Download sequence
Identical sequences ENSMEUP00000009005 ENSMEUP00000009005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]