SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009065 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009065
Domain Number 1 Region: 46-140
Classification Level Classification E-value
Superfamily PX domain 3.66e-24
Family PX domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000009065
Domain Number - Region: 219-378
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0256
Family BAR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009065   Gene: ENSMEUG00000009943   Transcript: ENSMEUT00000009966
Sequence length 428
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2179:6635:28885:-1 gene:ENSMEUG00000009943 transcript:ENSMEUT00000009966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPKPQVIEQREPASFRMQVTQGNPLLLPHTLSELLARDTVQVELIPEKKGLFLKHVEYEV
SSLRFKSSVYRRYNDFVVFHEMLLQKFPYRMVPALPPKRMLGADREFIETRRRALKRFIN
LVARHPPFSDDVVLKLFLSFSGSXXXXXXXXXXXXXXXXXXXXXXXXXXXDFLPADIQAQ
FAASRELIRNIYNSFYKLRDRAERIASRAIDNAADLLIFGKELSALGSDTTPLPSWATMN
NSTWGTLKQALKGLSVEFALLADKAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKG
VLHKHQRALHKYSMMKKQMMSATVQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCL
HQETQLIHVYLPLTSHILGAFVNSQIQGHKEMSKVWNELKPKLSCLFAGPNNMPTPPRSP
QEGNVFPH
Download sequence
Identical sequences ENSMEUP00000009065 ENSMEUP00000009065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]