SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009220 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009220
Domain Number 1 Region: 389-504
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.55e-44
Family Pyk2-associated protein beta ARF-GAP domain 0.00018
Further Details:      
 
Domain Number 2 Region: 2-209,251-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-37
Family BAR domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009220   Gene: ENSMEUG00000010076   Transcript: ENSMEUT00000010135
Sequence length 817
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4107:11595:81287:-1 gene:ENSMEUG00000010076 transcript:ENSMEUT00000010135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEFEECIKDSPRFTATIDEVETDVVEIEAKLDKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXECLQKFGDSLQEMINYHMILFDQAQRSVRQQLHNFVKDDVRKFKE
TKKQFDKVREDMEMSLVKNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQXXXXXX
XXXXXXXXXILSLKPARSCSFQHGQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFSYD
ESKVEFDVDAPNGVVMEGYLFKRASNAFKTWNRXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XRLDRTASPSTSSIDSAPDTRDRSSKGEGILQRVQSAAGNGQCCDCGQPDPRWASINLGI
LLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSTVNQIYEAQCEELGLQKP
TASSSRQDKEAWIKVKYVERKFLKKEATETAGGGEAKPRRWSMKKCRRHQSSPRVPRMRR
QLRQEPHLPAALSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSSDSGLGG
STDGSSDILVFGSVVDSVMEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXAEVNWVNEEDESKTPLIQAVLGXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRLARMNEE
MREAEGPLGQPGTPSSPTELQYRKCIQEFISLTIDEC
Download sequence
Identical sequences ENSMEUP00000009220 ENSMEUP00000009220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]