SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009266 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009266
Domain Number 1 Region: 175-272
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000000837
Family FCH domain 0.069
Further Details:      
 
Domain Number 2 Region: 25-124
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000267
Family BAR domain 0.087
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000009266
Domain Number - Region: 301-355
Classification Level Classification E-value
Superfamily HR1 repeat 0.00314
Family HR1 repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009266   Gene: ENSMEUG00000010147   Transcript: ENSMEUT00000010188
Sequence length 437
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6830:4768:44348:1 gene:ENSMEUG00000010147 transcript:ENSMEUT00000010188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDPLTNCSYNKVYNDLKEVSQNGENFCKQLTSILQQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXCICGAWTFASESMKSAADLHQKLGKAIQLEAIKPTHQVLSAQEKKKRTLDNEVE
KTANLVINXXXXNNWSQQIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLNKLKK
STEKLAKEDENYYQKNIAGYTTRLKWEATLQNCYQNVLDLEKERIQLLCNILNQYNQHVS
IFVQTLTSGHTQLHCAISKIDVEKDITTLMEETAISTTEEKSEFLLTDYFEEDPTNGMDK
ERRKSSIKSKLSRLQEDIEKASRDKEGLERMISVYTANPSFSDAKTRKETAVLLDEXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQTHSSVKISRPFMMKRLETVV
TRASSSEPSNKLQSPSL
Download sequence
Identical sequences ENSMEUP00000009266 ENSMEUP00000009266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]