SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009293 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009293
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000164
Family BAR domain 0.064
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000009293
Domain Number - Region: 173-214
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0837
Family BAR domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009293   Gene: ENSMEUG00000010196   Transcript: ENSMEUT00000010217
Sequence length 244
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6113:9041:20749:-1 gene:ENSMEUG00000010196 transcript:ENSMEUT00000010217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSQVRVMENTVNNAEKYFGQFCVLLAAYTRKTAKLRDKADLLVKQLLDFANTENPEMRTT
LKNFAEELAKVQDYRQAEVERFEMKVIHPLRLYGTQIKQTRNEIKKFNKVRNNEIKQLEK
LERLRQKSPSDRHTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIFSDFVT
IEMVFHAKAVEVYSQAFHILENYDLERDLEDFRAKIHGVSGNLDARPINATNPSSSVPWS
FASP
Download sequence
Identical sequences ENSMEUP00000009293 ENSMEUP00000009293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]