SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009688 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009688
Domain Number 1 Region: 80-200
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-32
Family C-type lectin domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009688   Gene: ENSMEUG00000010631   Transcript: ENSMEUT00000010650
Sequence length 203
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3185:9145:20724:1 gene:ENSMEUG00000010631 transcript:ENSMEUT00000010650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMGDRGQKGSVGRHGKIGPIGSKGEKGEMGDVGPPGPNGEPGIPCECSQLRKAIGEMDNQ
VAQLTAELKFIKNAVAGVRETDNKIYLLVKEEKRYIDAQLYCHGRGGNLGMPKDEAANGL
LASYINQAGLTRVFIGINDLEREGTFVYSDRSPMQTFNKWRNGEPNNAYDEEDCVEMVAS
GGWNDVACHITMYFICEFDKENV
Download sequence
Identical sequences ENSMEUP00000009688 ENSMEUP00000009688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]