SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009876 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009876
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-29
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 32-77
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000944
Family Link domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009876   Gene: ENSMEUG00000010829   Transcript: ENSMEUT00000010854
Sequence length 277
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3572:1234:19724:1 gene:ENSMEUG00000010829 transcript:ENSMEUT00000010854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIALIYFFVLLWDEAQGWGFKDGIFHNSIWLEQAAGVYHREARAGKYQLTYAEAKAVCEY
EGGHLATYKQLEAARKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
ERWDAYCYNPNAKECGGVFTDPKRIIKSPGYPREYEDNQICYWHIRLKYGQRIHLSFLNF
NVEDDIACLADYLEIYDSYDDIHGFIGXXXXXXXXXXXXXXXNVMTLKFLSDASVTAGGF
QLKYVAVDPASKTGEGKNASTSSHGNKNILAGRFSHL
Download sequence
Identical sequences ENSMEUP00000009876 ENSMEUP00000009876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]