SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009967 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009967
Domain Number 1 Region: 722-827
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 7.81e-28
Family Lipoxigenase N-terminal domain 0.068
Further Details:      
 
Domain Number 2 Region: 32-142
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000297
Family C-type lectin domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000009967
Domain Number - Region: 1363-1390,1428-1554
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0596
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009967   Gene: ENSMEUG00000010885   Transcript: ENSMEUT00000010951
Sequence length 1558
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9167:217:60947:-1 gene:ENSMEUG00000010885 transcript:ENSMEUT00000010951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFQTGIWLWLCIGQNVLRGAGLNLQKEHRKSDCYQLNRIHCSFRGAQHYCHRQGGQLMS
TWNQDIRNHLKDYLEEGKKWWIEPDSHPLIKREKRCPAEVSANLFTRSGLFPSNRCTYMI
RNWDLVSSKVDLCSKEHFFICQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXPTTLCQEMSTNILVLFVMAQTPEQMLLAISPPSSPLPVKTK
FGKPVAETSSEKPLSEALAVFREAMGNVSRSIQDVQLVQKVQRACEILQHLKHFASQFSK
TIQINSLLYPSEQLLKVQSPSGNPFSRKAPIALCSFDSFSYDMESVGMSRVGAQQDSMQM
EDTLETSLIALGNIQEALLLASQPSESSMIVTSSLATLMLRSQNISTLSSSSYTLGYPAP
LRLGLPSASAFHNLLSKHQNVNIQVTGLAFNPFKHFDERDIVGSIGNVLLTSNHKSLRIQ
DLLEEAEIILWRDGSIETYPTSFNMSTDCFVITINITSLKESLIVWVEPENSLSITLYLG
FQYQPNVTHFHLNITLPKEQIWEKXXKYSWVLSPESLQHGAGTYYITAVVNESKKAPNRT
SQRFSVTMAATQCYFWDHRNKTWKSNGCRVGPQSTVTKTQCLCSHLPSISSSFKTVARTV
NIQDTVKLFHGVSRNPIGVSLLASLFGFYIIFIVWAWRKDGEDMKKMKVTILADNCPNSQ
SHYLVQVFTGYRRKAATTAKVILILYGSEGRSDPHHLSDPHKVLFEQGAQDVLLLTTRFP
LGELHSIRLWHDNSGTSPSWYVNQVIVSDLTTSKKWHFLCNCWLAVDLGDCRQDQVFTSV
SKKELFSFRNLYSSMIVEKFTQEHLWLSVVTCSPWNQVTRVQGLSCCMTLLICSMLINIM
FWKLNGESFAVTSSELLISIQTASILFPINLIIGRIFPLIQLQEKIPPHFIPIQASSTLD
TSFGPVTTQKIIEELKEIVGFLHMKNACLPSQWAPGSSDSITDLIKGLSSLINSHLERQG
SQWQQTGSHLKNEVPENLRNLNHYLLRVLERLQFQCSTLKLFQPHDFLHSAGQLQSLREL
METQILTMAQGPCSDIMSFPMLDSEEEKSTILNYLPKWSIYVCWLLLGVTSLVSAFFTAL
YSLKLNKDQATSWVISMLLSVLQNIFIIQPVKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQILFLVMLM
ISTHSERILSRFYLNQAIHKKINNHFEEIKRIEDFYQWTNNTFIPNLYGEYRGKGXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNRMKQRWEYFTKKSNALDTSIL
LLTFTMLLLQLKCFFLHRRDMEQYRQNKSRFISFHESVQVSCALTYLLGVLVLLTTIRLW
SLLQLNTRLQVISTTLKRAWDEAAGFLLIILILLTGYSITFNLLFGWSISDYRTFFNSAI
TTVCLLKGIFDYHEVITLDPVLGSFLITISVIFLVLVIINLFASAIILTFRKERKSIM
Download sequence
Identical sequences ENSMEUP00000009967 ENSMEUP00000009967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]