SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010209 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010209
Domain Number 1 Region: 384-513
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-36
Family Ran-binding domain 0.000000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010209   Gene: ENSMEUG00000011189   Transcript: ENSMEUT00000011223
Sequence length 565
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1266:12512:74886:-1 gene:ENSMEUG00000011189 transcript:ENSMEUT00000011223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLANEEKPAIAPPVFVFQKDKGQKSSAEQKGLSDSGEEPLGEAESPHHGMGHTESAGE
HALELPTPASASASASPPPASEARPTSIXXXXXXRSADGSSPEDGEDSDREDGNYCPPVK
RERTSSLTQFPPSQSXXXXXXXXXXXXXXXXXXXXXXXLPSQKPKEQQRSVLRPAVLQAP
QPKALSQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKETQKNES
SNTSKDETCERKKQIAQQAFVFGQNLRDRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXLENSTNNADASSNKFVFGQNMSERVLSPPKSSESSIDTNKDNTAAESGSESSSL
EATPEKESLAESAAAYTKATAKKCLLEKVEVITGEEAESNVLQIQCKLFVFDKTSQSWVE
RGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDT
EDQGVKVFLISASSKDTGQLYAALHHRILALRSRIEQEQETKIPAPEPEVTQSNEEDSDD
DVLAPSASTGGGTGDEGDGQTVGST
Download sequence
Identical sequences ENSMEUP00000010209 ENSMEUP00000010209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]