SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010248 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010248
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-30
Family C-type lectin domain 0.00000333
Further Details:      
 
Domain Number 2 Region: 288-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 3 Region: 415-484
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.06e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 351-425
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 5 Region: 228-294
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000431
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 471-536
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000089
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 165-237
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000432
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 129-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000146
Family EGF-type module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010248   Gene: ENSMEUG00000011233   Transcript: ENSMEUT00000011263
Sequence length 599
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_140:3825:14027:-1 gene:ENSMEUG00000011233 transcript:ENSMEUT00000011263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFERSDAWLYASSEVNMTYEMARKYCQERYTDLVAIQNKHEIEYLNRTLRFSPSYYWIG
IRKINGVWTWVGTQKSLTEEAMNWAPGEPNNKQNNEDCVEIYIKRSKDSGMWNDERCTKE
KLALCYTASCNSNSCNGHGECVETINSFTCQCYPGFTGSQCEHVVTCESRGQSEHGRLVC
SDPRWGYFISSCSVSCEEGYVPTNANSVQCTSSGKWSRPSPTCKVVECDALTSPAHGSMN
CSQSSGIFPWNTTCVFGCESGFELKGSKKLHCSSSGKWDMERPTCQAVKCNAPSQPHHGF
VKCVHPPTGDFTYQSVCNFSCEEGFEPKGSSLLECTAQGQWTQKFPTCEAIQCKAPTRPE
RGHMECLPSLSGSFQSGSSCEFSCEEGFMLKGSKRLQCNLTGQWDMEEPTCEAKKCDAVS
QPQNGSMTCAHSSTGDFTYQSVCSFICEEGFALQGSPQLECTAQGQWTQQMPTCEAVQCS
TLKVPKEINMTCDGDGNFLYGTRCVFECPEGWKLNGSDSLACRATGNWSGMSPSCEAPEE
SNTSLVVGLAASGTSLLTTASFLLWLAKRLRKKXXXXXXXXSCQSLDSDGIYQAASELI
Download sequence
Identical sequences ENSMEUP00000010248 ENSMEUP00000010248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]