SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010301 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010301
Domain Number 1 Region: 5-166
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.72e-22
Family FCH domain 0.022
Further Details:      
 
Domain Number 2 Region: 199-265
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000419
Family FCH domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010301   Gene: ENSMEUG00000011273   Transcript: ENSMEUT00000011321
Sequence length 745
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6370:310:104673:1 gene:ENSMEUG00000011273 transcript:ENSMEUT00000011321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMAHFVESFWGERNNGFDVLYHNMKHGQISTKELADFVREXXXXXXXXXXXXXXXXXXX
XXXXXXTFAPVWDVFKSSTEKLASCHLELVRKLQELIKEVQKYGEEQVRAHKKTKEEVAG
TLEAVQNIQSITQGLQKSKENYNAKCLEQERLKKEGATQREIEKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXKFQDIEETHLIHIKEIIESLSKAIQEIHLQIGQIHEEFINN
IANTTVEGLIQKFAESKGTGKERPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXECPDADSVXXXXXXXXXXXXXXXXXXXXTKENHFYSSSDSDSEDEEPKKYRIEIKP
VHPSNSHHTMASLDELKVSIGNISLSPAISVSNIKSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPTTPLSAGTIVPPPRPTSRPKLTSGKLSGI
NEIPRPFSPPVTSNTSPPPAAPLARAESTSSISSSASLSAANTPTGVSRGPSPVSLGNQD
TLPVAVALTESVNAYFKGADPSKCVKITGDMTVSFPSGIIKVFTSNPSPAVLCFRVKNTS
KLEQLPNSQLIFSDPSQCDSSAKDFWMNMQAVTVYLKKLAEQNPSASYYNVDVLKYQVSS
NGIQSTPLNLATYWKCNASTTDVRVDYKYNPEAMVAPSVLSNIQVVVPVDGGVTNMQSLP
PAIWNAEQMKACWKLSGISEKSENG
Download sequence
Identical sequences ENSMEUP00000010301 ENSMEUP00000010301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]