SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010332 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010332
Domain Number 1 Region: 27-148
Classification Level Classification E-value
Superfamily PX domain 1.57e-33
Family PX domain 0.0005
Further Details:      
 
Domain Number 2 Region: 183-371
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000319
Family BAR domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010332   Gene: ENSMEUG00000011320   Transcript: ENSMEUT00000011356
Sequence length 387
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6753:22661:53934:1 gene:ENSMEUG00000011320 transcript:ENSMEUT00000011356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMNSFSPLMPTSPLSMINQYKFEDEPDSKDLFITVDDPESHITTIETFITYRVTTKTSR
GEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIMKGMVERFNDDFIETRRKA
LHRFLNRIADHPTLTFNEDFKVFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSVRGVK
NRPEEFTEMNDYVGTFSQEINLIDKISHRIYKEEKEYFEEMKEYGPIYTWWSASEEDLVD
SLKGVASCIDKCCKATERRIFDLSETLLPVVHEYVLYSEILMGVMKRRDQIQAELDSRVE
ALTYKKTEKEVLSEEIGKLEDKVECANNALKADWDRWKQNMQNDIKLAFTDMAEKNISYY
EQCLATWESFLTTQTDLHLEEISEDKP
Download sequence
Identical sequences ENSMEUP00000010332 ENSMEUP00000010332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]