SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010397 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010397
Domain Number 1 Region: 1573-1725
Classification Level Classification E-value
Superfamily FAS1 domain 9.81e-27
Family FAS1 domain 0.0025
Further Details:      
 
Domain Number 2 Region: 525-655
Classification Level Classification E-value
Superfamily FAS1 domain 9.55e-24
Family FAS1 domain 0.0023
Further Details:      
 
Domain Number 3 Region: 1136-1264
Classification Level Classification E-value
Superfamily FAS1 domain 9.55e-23
Family FAS1 domain 0.0028
Further Details:      
 
Domain Number 4 Region: 1739-1878
Classification Level Classification E-value
Superfamily FAS1 domain 2.49e-22
Family FAS1 domain 0.004
Further Details:      
 
Domain Number 5 Region: 397-505
Classification Level Classification E-value
Superfamily FAS1 domain 3.66e-18
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 6 Region: 2234-2286
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000137
Family Link domain 0.00071
Further Details:      
 
Domain Number 7 Region: 1061-1129
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000000602
Family FAS1 domain 0.0035
Further Details:      
 
Domain Number 8 Region: 2283-2362
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000569
Family FAS1 domain 0.018
Further Details:      
 
Domain Number 9 Region: 1473-1512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.067
Further Details:      
 
Domain Number 10 Region: 1515-1553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000493
Family Merozoite surface protein 1 (MSP-1) 0.079
Further Details:      
 
Domain Number 11 Region: 2414-2446
Classification Level Classification E-value
Superfamily FAS1 domain 0.000017
Family FAS1 domain 0.0097
Further Details:      
 
Domain Number 12 Region: 2080-2117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00004
Family Merozoite surface protein 1 (MSP-1) 0.06
Further Details:      
 
Domain Number 13 Region: 241-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000623
Family EGF-type module 0.054
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000010397
Domain Number - Region: 868-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000288
Family EGF-like domain of nidogen-1 0.094
Further Details:      
 
Domain Number - Region: 2127-2160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000568
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 199-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00605
Family Merozoite surface protein 1 (MSP-1) 0.072
Further Details:      
 
Domain Number - Region: 1443-1482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0323
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010397   Gene: ENSMEUG00000011359   Transcript: ENSMEUT00000011427
Sequence length 2525
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4557:15787:155046:1 gene:ENSMEUG00000011359 transcript:ENSMEUT00000011427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMRKSLKPSFLLGFIIHILCSLAGALEQAKRCDKKTLITTRTECQSCSLNRRINCPEGYT
KVTNGSSGVRDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXEGFGGTACETCAEENLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXIPECDALLCPENSRCSPSSIDESILECKCLPNYQGDGRHCEPIN
PCLQKVCDDNAHCTYLGPNRHRCTCRDGYKGDGQVCVPVDPCQEDFGGCPAQSTVCQYDS
PGKXXXXXXXXXXXXXXXXXXXXXXXXXXXNPCHKNANCTMRAPGQTXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAYAWPLSNLGPFTVLVPTNKGLKGTN
VKELLMDKNNAQYFVKLHIIAGQVDTEALNSTDTFYTLTGKSGEILSGDKDDQLRLKLSG
GKKKGKIVRGDIIASNGLLHIIDKAMDMAPLFEASTEQTIMTMLQPRYSRFRSLLEVTNV
GQALGEDGVGGPYTIFVPSDEALNNMKDGILDYLLSAEGSRKLLELVRYHIVPFTQLEVA
NIISKPHIRTMANQIIQFNTTSNGQILANEVAVEEMEVVAKNGRIYTLAGVLIPPSIIPI
LPHRCDETHRDMKLGTCVSCGMVYWSVCPANSEPLXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXIPKCCKGFYGPDCNQCPGGFSNPCSGNGQCADGLSGNGTCICDDGFQGSRCQFCSD
PGKYGPQCEKKCLCVHGKCDNRIDSDGSCLPGTCKDGSAGKFCDKQTTACGPYVQFCHIH
ANCEYSSRVASCVCKQGYEGDGTICTEVDPCAGIIPGGCSSNAECVKTGTGTHMCVCQPG
WTGDGRDCTAINNCLLPNFGGCHDNATCLYVGPGQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXANCQSTSSGLWSCVCQDGYEGDGLMCYGNVAVXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYHALVGTYRTSDLQILSSS
DMLATSLQGNFLHLAKVNGNITIEGANIVDSDNAATNGVIHVIDKVLLPQRSMSTSLPNL
LSRLDQMPDYSIFRGYIIQYNLATAIEAADTYTVFAPNNEAIENYIRKKDWSLEESILRY
HIILEEKLLKNDLHSGMHRETMLGFSYLVGFFLQNGQLYVNEAPVNYTNVATDKGVIHGL
GKVLEIQKNRCDSNYTTIVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXTKECCAGFFGPQCQLCPGKARNACFGNGICLDGVNGTGVCECEGGFNGT
ACETCMEGKYGSSCDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXCLLKSDGTAYCKCAAGFQGNGTVCTAIDACEISNGGCSTKADCKRTTPGKRVCVCR
AGYTGDGIICLEINPCLENNGGCDQNAECTQIGPNKAACNCLRGYAGDGKTCTINICLTR
NGGCSEFAVCNQTAVEERTCTCKPGYKGDGFICRGPIYLELPKNTATTPYFFHLQENTIR
DLMGPGPFTVFVPSKEALENASQVKAWTTQGVMPQMLRYHMVSCHQLLLENLKLIPSMTS
LQGEAVHITVSQDTVYLNGKAKIISSDIICNNGVIHIIDQVLVPKNLQEIHKDASGNNME
NLTSVAIRQGYLKFSSMLQDAGLLSVINDPIHKPVTLFWPTDKALEALSQEQQNFLFDKD
KLKDYLKFHIIRDSKILAVDLPSVASRKTLQGSELNVKCGDENNIGDLFLNDQKCRIVQR
QLEFESGVAYGIDCMLMNPSLGGRCDNFIIFNVSGSCGSCYNVPRCPTWSKPKGVKQKCF
YDLPFRRHVEGCQQKCTMVMRLPKCCKGYFGRDCQACPGGPTTPCNNRGVCIDEYSGGGE
CRCNTGFNGTACELCWPGRYGPDCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLPPVCSPSCSKYATCKENGTCECNLHYEGDGITCTVVDYCKQNNGGCSKVAKCSQVGTV
VTCSCQKGYKGDGHICIAVDPCADGLNGGCHEHAVCIMTGPGKHRCECKSHYVGDGLDCV
VEQLPVDRCLQNNGQCHADANCADLHFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXAKYHLCSAGWLNDGRVAYPTAYSSQNCGSGFVGIVDYGSRPNKSERW
DVFCYRIKDVNCTCKVGYMGDGFACNGNLLQVLMSFPSLANFLSEVLIYSNSSSRGKAFL
KHLTDLSTHGTLFVPNNDGFWENKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXNETRFVDGQAILQWDIFASNGIIHIISGPLKAPPAPTXXXXXXLGAEVL
TIIVGAIALAGYYFRINRRTIGFQFEPEEDIDVTALGKQPSSNISNPMYDSTTTQPPEPT
YDPFS
Download sequence
Identical sequences ENSMEUP00000010397 ENSMEUP00000010397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]