SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010513 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000010513
Domain Number - Region: 270-325
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0628
Family FCH domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010513   Gene: ENSMEUG00000011533   Transcript: ENSMEUT00000011561
Sequence length 412
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3405:5:29783:-1 gene:ENSMEUG00000011533 transcript:ENSMEUT00000011561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKVCRREREAGVRAQRVINTAYSASHQTSPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXEAIREAKNLEKQMVEKPEVCNDTMLALWEECKPCLKQTCMKFYTKVCRSGSGLVGRQ
LEEFLNQSSPFSIWINGDRMDTLLKDDQEQNQRLMNLEEDYSLVQRNLDELFQGSPLFPE
NTHPFFISQNGTNDRMVCREIRRNSAGCLKMKDQCEKCREILSLDCSDTDPSQSRLREKY
EDALRIVEKFDREYEDLLQMYQLKMLNTSSLLNQLNQQFGWVSRLANLTQSKNGDYLQVS
TVYSRSSNPEDPSKPSDTEVVVQLFDSEPITLTVPAEISWDDPKFMEIVADE
Download sequence
Identical sequences ENSMEUP00000010513 ENSMEUP00000010513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]