SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010624 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010624
Domain Number 1 Region: 594-730
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-43
Family C-type lectin domain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000010624
Domain Number - Region: 218-422
Classification Level Classification E-value
Superfamily Tropomyosin 0.00085
Family Tropomyosin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010624   Gene: ENSMEUG00000011658   Transcript: ENSMEUT00000011689
Sequence length 738
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6457:6159:71629:-1 gene:ENSMEUG00000011658 transcript:ENSMEUT00000011689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFAEEDEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYKVVE
KMDNVTGGMETSHLRYNEKLTEVESGLKKLXXXXXXXXXXXXXXXXXXXXXXXXXQQLRE
ITEKTSKNKDALEKLQESGDILDDRQSQMKETLENNSFLITTVNKTLQAYNGYVNNLQQD
TSVLQGNLQSQMHSHNVVIMNLNNLNLTQVQQRNLISSLQRSVDDTSQAIQRIKNDFQNL
QQVFLQARKDTDWLKEKVQNLQMLAANNSALAKANNDTLEDMNSQLNSFNGQLDNITTVS
QANEQNLKDLQDYHKESENRTTTKFNQLEERFQLFETDIVNIISNISYTAHHLRTLTSNL
NDVRTTCTDTLTKHTDDLTALNNTLANIRLDSTTLRMQQDVMRSRLDIEVANLSVIMEEM
KLVDSKHGQLIKNFTILQGPPGPRGPKGDRGPQGPLGPTGNKGQKGEKGEPGPPGPTGER
GPVGPIGPPGDKGSKGSKGSQGPKGQRGSPGKTGPPGPSGDPGPPGPAGKDGAPGPQGPP
GFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGPPGPPGPSGAMAPLALQNEPTPAPEP
NGCPPHWKNYTDKCYYFSTEKEIFHDAKLFCEDKSSHLIFINTREEQQWIKKQMVGRDSF
WIGLTDSEQENEWKWLDGTIPKYTNWKTGQPDNWGHGHGPGEDCAGLIYAGQWNDFQCED
INNFICEKDREPASTSAL
Download sequence
Identical sequences ENSMEUP00000010624 ENSMEUP00000010624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]