SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010687 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010687
Domain Number 1 Region: 2962-3119
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-41
Family C-type lectin domain 0.00000421
Further Details:      
 
Domain Number 2 Region: 253-358
Classification Level Classification E-value
Superfamily C-type lectin-like 3.98e-29
Family Link domain 0.0039
Further Details:      
 
Domain Number 3 Region: 27-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000119
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 
Domain Number 4 Region: 2916-2957
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000625
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 5 Region: 3120-3176
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000473
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 6 Region: 208-258
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000612
Family Link domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010687   Gene: ENSMEUG00000011681   Transcript: ENSMEUT00000011761
Sequence length 3220
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_399:20685:104867:1 gene:ENSMEUG00000011681 transcript:ENSMEUT00000011761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSIKSVLWIYSTLVVIHAVREVKVEKSPPVKGSLSGKVSLPCHFSTMPTLPPSYNTRS
EFLRIKWSKIEEDKSGKDLKETTVLVAQNGNIKIGQGYKGRVSVPTHPEDVGDASLTMVK
LLASDAGLYRCDVMYGIEDTQDTVSLAVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXYPIRAPRVGCYGDMMGKEGVRTYGFRAPHETY
DVYCYVDHLEGDVFHVTGPNKLTFEEAEEECANQDARLATVGELHAAWRNGYDKCDYGWL
SDASVRHPVSVARAQCGGGLLGVRTLYRFENQTGFPLPDSKFDAYCFKPKQNISETTTIQ
LNIPVETAPPSLSKEPQIIPIQVTPGIPLITELPVTQSDIPPIGKIVNIEQKVTIQPKAA
IGSSTAGSTERFWDMEYTPSASGPLEKPNISENKFLSCYQLPQNGVLQHETATDLWERHT
EDTQTQEVITQTEEIEVGPLVTYPEASEHPPVKESFTLGTLDVSTGMKKTEKETTNIIIS
GLGPSDHYEFTPREDEEAHTIQPDQNIFAISQIPEVVTVSKITEESNLTLMEHTDSITTD
TVALPEVMPTKEGSSIDSWEETQTSGKMTEDFSGQHGSTPLPLENHTEVKFFAPSQDLTS
LQGLVEGTSTLIYHDQQTEREHTPKPETTTVHRATEETEKDMTKDPLFRRIEEEEFSGMK
PSLEKTDVTEYTDEMTKYFDFSTTTTKISLEPIKEKDIEEVFTVTPDTTKMEENTTKIHS
ISSTLNLEVITVSKWPLDEDSMTSKPLASTEHIGTTELPTALLTTAGATEIETGRTFPLT
TDTTQRPMVEFTEESWKDKEEFTVSSHSTPQTGVKEETVVKYSPTEGVVDTTMEGSAIDE
GLDLDTPKSVTTVHQFAQTVYGEGPEFVDHSSSTQEPPAHVEAAQTVSLIPSVSSEGKAT
QDVHLVDQIPFEATRSLETTQTISKSTQVPLRFPEKEQPTEYPVFATDSVATTSSEVPIT
PQGKDTDEHDFDGSAYPTSEDGLVTDSKQVLVFRTTVGATETSTSYPHYVSVTEHKVKTE
VEMVTLGTTLEGHLRPKPEQEAERRASSPSTWESRSPWSPFTTERVPQGTEETTSGKKEE
TSQDYTEVGSGLLEEPKGAETVMLTAVATVKTAVPSDVTTLFSSLDKIHSTSTSKSFVTK
EKPVIIDREPGEETTSDMVIIGESTYHVTPTPPDDMVTKELETDIDREYFTTSSASSIAQ
TTRQPTTEEGKDALESQEVSTSEPQARETIRPDINVYVITVTGNETGRMSDLSVIGHPID
SNSKEDEPCSEENDDQSAILSFLPDFIEIEPYFVDEEDDDCENSTEVTTSPPVKYLNGKH
LVTTVPKDPETAEARRGQFESAAPSPNFSHSSETNHFELSEMESSTILQPSESKETLESF
EITWKPDTYPETPEPFSGGESGVFPTDQQSGTTALRRRGSLEVAEPVMHNGPEPLNRSHG
NNETTPSFPEESSGDALAHQEIQGADFARTTEVALKEVVGHDAMVTSAPMTVPDSVSVDI
LPEERSSVLTGNQQADPISTVESWEDTTSRHTVEILGNTPLGLIPEGSGFVEEDSNKTST
VVASLLQRDAIKKVPLDDSKAIPTESIFGISTSANYPVWEESSIEILTAKFETQTEVPKS
TSTNSIHTSGLEKNLADERETTRVLATSMKVSSTQPTEEQSVFTSESSNSVEAKPTNLDS
TPLKTSTQFERDTVKSDPIPTESLFSKKLEEEYTDEKSTTQYKVPESPTPIGVSSGSFLL
EEGSGDVGSAMGPTTETLASLVLKVTEDSEVQTEHKAKEMAATLPSYVTHAVPSEPTGST
LNSVTDESDVVTLNQMVREKLSTEKLQEPSYGTEVSDIPTDFPLKEVVTPETRDYSTAAH
LITEEETVVVEGSGDKTFMESEIIIPLATVTLASLSGTDSEGPGSTMVSLPAHLPGKFPF
LTEGSGEDPTKINSSIDHIPPSTTEKTYIRSKETKEGDISFVNTIPDLGIFVPHTEATKE
SPFSFDGISVTESQISENTGRQPAIKEKDNVKHFPENNGPENLRPTVQEFHTEAVFSGEG
SGDEVFPSQSTLPFSFSGTEENTSILTPDTHQPKSSEPSLAPEKTEGLDSREHMEIGYHG
FQTNNALETSHTVANTLLFESSKDNDDEESTLSPITHSLKIEDSENQSFNGVEETQISKQ
QTITEKLSQENSAQLETKAVTSSTIPFTKPSSLETAKIFVTLAPQIPYQSNESSGEGSGW
LDGAESVHASRITQTAVAITTVVPHSHEGKYSAFPSMEVLATNELPPKVLPTHTEQNKSS
QNLPGTQPNLMTFESSTSHSPDGSKDFEDITLTPETRKFAENIILDLDKEDSDLILPTAK
STAFEVLPDITPDKNIIIDIDHTKTVYEDILRVQTETDPELQSVPYGSNEENMQVEEKED
VAFNLSFTEEKAEGSGDNLWVGSTQAISNESAVSEDGIGLSQDDISRKSVHFTTGIPLPS
MATELGVLIPTASSLAIPSMSPTVSQDMKEPQFEAKTLDDLFESSTLSDGQPVADQSEEI
STLSYLEGTQSEDDGKKFMSPSFKPELSSGAEEELFNNTVDVNVATIKFITQSLTETPEV
IEGSNPTEYIEATSDSASAELYSQTPSSEAIVHLVDSASEYPKVIIPSSASTTDSNAYQI
SLEQTFEEVNSNAEVTFKPPAEVSSHRIDFPFLTSPATALAVEETELSATEVLIAEEETK
TPEYSQVFTDLIFSGETTKAPPGINLPEDGTSPEAPGESNLEDPLQGLLSIPTSANYDLV
GGVLFQSGPPAAENPTTPFTSIKINTETQSVIVVANNQIPARTPDSDDQAMISTVELNTE
HITSSFLLMESSNGTDFLIGTNEDSVEGTAVYLSGRDLCKTNPCLNGGTCYTRDTTYVCT
CVPGYSGDQCEFDFDECQSNPCRNGATCVDGFNTFTCLCLPSYVGALCEQDTETCDYGWH
KFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQLFVNRVGHDYQWIGLNDKMFE
HDFRWTDGSTLQYENWRPNQPDSFFSSGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTV
ACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNRWAPKNTCQNPS
TYQRTYSKKYLKNSSSAKDNSINSPKHYHRWSRRWQDSRR
Download sequence
Identical sequences ENSMEUP00000010687 ENSMEUP00000010687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]