SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010871 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010871
Domain Number 1 Region: 135-247,294-859
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.7e-205
Family Motor proteins 0.000000000000145
Further Details:      
 
Domain Number 2 Region: 1288-1404
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.45e-25
Family Myosin rod fragments 0.0052
Further Details:      
 
Domain Number 3 Region: 892-1016
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.11e-24
Family Myosin rod fragments 0.00000356
Further Details:      
 
Domain Number 4 Region: 1014-1124
Classification Level Classification E-value
Superfamily Myosin rod fragments 6.54e-22
Family Myosin rod fragments 0.0014
Further Details:      
 
Domain Number 5 Region: 81-116
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0000000275
Family Myosin S1 fragment, N-terminal domain 0.0024
Further Details:      
 
Domain Number 6 Region: 1120-1235
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000173
Family Myosin rod fragments 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000010871
Domain Number - Region: 1909-1979
Classification Level Classification E-value
Superfamily Tropomyosin 0.00536
Family Tropomyosin 0.013
Further Details:      
 
Domain Number - Region: 1697-1797
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00654
Family Myosin rod fragments 0.0083
Further Details:      
 
Domain Number - Region: 1562-1604
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00785
Family Myosin rod fragments 0.012
Further Details:      
 
Domain Number - Region: 1405-1513
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0139
Family Myosin rod fragments 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010871   Gene: ENSMEUG00000011883   Transcript: ENSMEUT00000011966
Sequence length 1988
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1043:3200:40201:1 gene:ENSMEUG00000011883 transcript:ENSMEUT00000011966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADKRGAAPGLHFGAEGLLPSVRLGPSSLTLRAPQLLLLFLISCHPTAISAAMMDLSELGE
AAAYLRKNYQEMVKVHTVPGDGKKWVWVPDEQEAYLEAEVKEIKAGRVTVETKDQKXXXX
XXXXXXXXXXXXXXXXEDMSMMTHLNEASVLHNLRQRYAHWMIYTYSGLFCVTINPYKWL
PVYTTAVVAAYKGKRRSEAPPHIYSVADNAYHSMLQNRENQSMLITGESGAGKTVNTKRV
IQYFAIVAALGEGPGKKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKF
IRIHFGPSGKLASADIDSYLLEKSRVIFQLPGERGYHIYYQILSGKKPELQDMLLLSLNP
YDYHFCSQGVTTVDNMDDGQELIATDHAMDILGFSVDEKCACYKVVGALMHFGNMKFKKQ
REEQEADGTESADKAAYLMGISSGDLLKGLLHPRVKVGNEYVTKGQSVEQVVFAVGALAK
ATYDRLFRWLVMRINRTLDTKLARQFFIGVLDIAGFEIFEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXDFGLDLQPCIDLIEKPMGILSILEEECMFPKASDVSFR
AKLYDNHAGKSPNFQKPRPDKKRKYEAHFEIVHYAGVVPYSIVGWLEKNKDPLNETVVPV
FQKSQNKLLASLYESYSFYSAEGPKSGVKEKRKKAASFQTVSQVHKENLNKLMTNLRATQ
PHFVRCIVPNESKTPGVMDAFLVLHQLRCNGVLEGIRICRQGFPNRLLYMDFRQRYRILN
PSAVPDDTFVDSRKATEKLLGSLDIDHTQYKFGHTKVFFKAGLLAVLEELRDERLAKILT
LLQARIRGHLMRIEHQHMRGGRDALYTIQCNIRAFAAVKNWSWMKLFFKMKPLLRSVQAE
EELGALRAELRGLRVSLAEAEAKRQELEEKHISIAQEKNDLSLQLQAEQDNLADAEERCD
LLIKSKVQLEAKVKELSERLEDEEEMNSDLTARKRHLEDECTELKKDIDDLELTLAKVEK
EKHATENKVKTLVEEMAGRDETIVRLTKEKKALQEAHQQGLDDLQTEEDKVNTLSKAKVK
LEQQVDDLESSLEQEKKLRLDVERAKRKLEGDLKLTQESVADGERDRRQLEEKLKKKDFE
MSQLNSRIEDEQVLGAQMQKKIKELQSRGEELEEELEAERAARARVEKQRAESAQELEEL
SERLEEAGGASAGQREGSRKLEAELGRLRRELEEATLRHEATMAALRRRQADSAAELGEH
IDSLQRARQKLEKEKSELRMEVDDLSANVEALTRGKTNAEKLCRASEDHLSEAKVKIDEL
QRQLADANAQRGRLQTENGELSRLLEEKESLISQLSRGKTSVTQSLEELRRQLEEETKAK
SALAHTIQASRHDCELLREQHEEEAEAQAELQRLLSKANAEVAQWRSKYEADAIQRTEEL
EEAKKKLAARLQEAEEVAEAAHARCSSLEKAKLRLQTEVDDVSLELERSTSAAAALDKKQ
RLLERALEERRRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XEISDLTDQISLSGKNLQELEKVKKALEGEKSELQAALEEAEGALELEETKTLRSQLELS
QVKADMDRKLAEKNEESENLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXTRQATEAHAATRLLQAQLQDAQVAQDEAQRVAGELREQAQALERRNGLLLAELE
ELRAVLEQGERARRLAEQELLEATERINLLHSQNTGLVNQKKKLEADVSQLSGEVEEAVQ
ESREAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKTLEQTVRELQVRLDEAEQVALR
GGKKQVQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVKELTYQAEEDRKNLARMQD
LIEKLQSKVKSYKRQFEEAEQQANSNLVKYRKAQHELDDAEERADIAETQVNKLRARTRD
ALTPKHKE
Download sequence
Identical sequences ENSMEUP00000010871 ENSMEUP00000010871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]