SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011098 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000011098
Domain Number - Region: 523-576
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00126
Family RILP dimerisation region 0.0081
Further Details:      
 
Domain Number - Region: 1080-1176
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00824
Family WD40-repeat 0.022
Further Details:      
 
Domain Number - Region: 37-178
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0272
Family BAR domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011098   Gene: ENSMEUG00000012149   Transcript: ENSMEUT00000012209
Sequence length 1337
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4950:7441:64627:1 gene:ENSMEUG00000012149 transcript:ENSMEUT00000012209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLISCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKK
DLQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGNSQTEGSLPGRSRKERPTSLNVFPLADGMVRGQIGGKIIPTVDHWHLSDLG
QLQSNSSYKCPQDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNDSLQPLGDYG
LGAKNSKRAREKRNSRNMEVQVTQEMRNVSIXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEISLLFVSGMGKEVG
NLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEATKQAKAKMETRVKELEE
ELKRVKSEAITARREPKEEVEDVSSYLCTELDNIPIAQRRRFTRVEMARVLMERNQYKER
LMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIHYK
SPTTAGFSQRRSHTMCQISAGSRTLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRL
QACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWKPN
EEDSGNGAKPSLGRDPLTCDREVEGENKSNHTSPEKKKGKELHEMDATSSRVWILTSTLT
TSKVVIIDANQPGTVVDQFTVCNAHVLCISSIPAASDTDYPPGEIFLEGDMNPEDSGADG
VLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGEVATVSNGKINQSQSTEEATEATEV
PEPGPSEVEVASVRPGTLTEHVFTDPAPTPTVNSQPSXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQ
KSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTG
KLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGP
RPGGIIHVYGDDSSDRSASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVL
DSPSENPGPAASDPEGQKLKNVLVLSGGEGYIDFRIGDGEDDESEENAGDVNQVKPMLSK
AERSHIIVXXXXXXXXR
Download sequence
Identical sequences ENSMEUP00000011098 ENSMEUP00000011098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]