SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011102 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011102
Domain Number 1 Region: 475-647
Classification Level Classification E-value
Superfamily Sec7 domain 4.19e-48
Family Sec7 domain 0.0000683
Further Details:      
 
Domain Number 2 Region: 686-823
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-25
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011102   Gene: ENSMEUG00000012151   Transcript: ENSMEUT00000012213
Sequence length 964
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3715:12995:33429:1 gene:ENSMEUG00000012151 transcript:ENSMEUT00000012213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDGQGLPGHPESMITWHMGENLQQLSGEHPKGVYGPPEIPGPCVDQAWVFDPANQDIPS
PSSPRERHHSGRDSQNNSTQVMFWAGILQAQMCVLDLEEELEKTDVFREELRRCIPSPVE
LPRDQGISSRPAHGDSEEDSSGPGGAQRGFPNRAPHSPVEWGEEEESLFFDNPIFLESPT
SVTSAHDEPFGASVSDGEERTEQGSLQPETLDPPCLGRKGLLELENKPESVVEVADPSRE
TDLLYPVPTYKLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESNAEQCPLTPGPWTPPA
SFQEPSSLGIGVRGLSPTLNPVQPLEGSFHSDSAFPEWRILAASYPSSLEKEEVDPDFLK
KTSEPLPPEKTVEHQEEIKAEAAEEAQXXXXXXXXXXSFQHLGSMVSQTESQGEGQKPES
KDKVANGVNPDQVAWKLASRLYHLDGFRKSEVAMHLQKNNDFSRDVAEKYLSFFQFKDKS
LDQALRGFLQALVLSGETHERERLYQFSKRFHHCNPGAFPSANAVHTLTCAVMLLNTDLH
GQNIGRSMSCQEFITNLHGLSDGGNFPKELLKTLYWSIRSEKLEWAVDEEEELATKPMKH
RPSISGSQKRRNTLVQFAQDPNVPTYKQGLLARKMHADVDGKKTPWGKRGWKMFHTLLRG
MVLYFLKQGEESCPENWPLEGPMPEEAVGVHHALAVPAVHYTKKPHVFQLRTADWRLYLF
HAPTAKEMTSWISRINLAAATHSAPPFPAAVGSQRKFVRPILPTGPARSSLXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTRYETYILILVTRLRYPSDD
LDLWESQMTKEAEGTWTPEPSLKKSHSSPSLHQEEAPTTAKVKRNISERRTYRKIIPKRN
RNQL
Download sequence
Identical sequences ENSMEUP00000011102 ENSMEUP00000011102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]