SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011112 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011112
Domain Number 1 Region: 61-192
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-40
Family C-type lectin domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011112   Gene: ENSMEUG00000012193   Transcript: ENSMEUT00000012226
Sequence length 200
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7412:17089:22997:-1 gene:ENSMEUG00000012193 transcript:ENSMEUT00000012226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REVFSLMLVIAGVSISFLSSCFIAKCVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKI
NTCCPLNWKKFQSSCYFFSDDGMTWTASLKNCEEMGGSLAVINTQEEHHFLFRAKPKGRE
FYIGLTDQVVDGNWQWVDGTPSTKLSFWDVGEPNNIVGFEDCVTIRDSSDANRNWNDITC
FFKMYRICEMSVRTFLTEKK
Download sequence
Identical sequences ENSMEUP00000011112 ENSMEUP00000011112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]