SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011294 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011294
Domain Number 1 Region: 1976-2145
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-33
Family C-type lectin domain 0.00055
Further Details:      
 
Domain Number 2 Region: 1702-1814
Classification Level Classification E-value
Superfamily CalX-like 4.05e-19
Family CalX-beta domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011294   Gene: ENSMEUG00000012357   Transcript: ENSMEUT00000012421
Sequence length 2146
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7173:12476:125111:-1 gene:ENSMEUG00000012357 transcript:ENSMEUT00000012421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAFLSREDLQFSIPKEKDACKVEVVMNEPITQRVGKLTPQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXFTETETFTETFILRVYLLEPDCSIIQMSTRALEVPEFYGLSRAIDKNV
LSFDYERRMNLECTIWLSPIENGLPAHGQVVVVESQQGKRRGDQPHSFFPESQYRKDPRC
PGGHCAPALKKIESLKVSCEEFLLMGLRYQHLSPPSPNVDYISIRLDLTDIRSQSIYKKS
ESVWLPVYIKAAFPNQIPRAAWMPTYILEVDQFILTSITTSTVDCEDDETPKSLLVFNIT
KPPLRGFFTHLLDHTKEISSFTWKDLRDMQIAYQPPNSSHTERRNYEVEFEVYDFFFEKS
LPITIHVSIRTADTNAPRVSWNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTRHKFPINILPK
DDSPPFLITNVVIELDEGQTVLIQGSMLKAADMDSSDDYIFFNITKPSQAGEIIKKPGPG
LIGYPVPGFLQRDLFNGIIYYRHFGGEIFEDSFEFVLCDSHDPPNLSEPQIVVIHITPVD
DELPKEVPGVVRHLVVKETEVAHLSKKHLHFVDTESHDRELLYTITTPPFFSFSYGRSDA
GKLFMADSILNLVKDPAAPGLRSFTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVLTNSLQVDEGGLRIITTEHILISDVDTKQDKLRLSLK
RLPLHGMVELDGFPLSHGKEFSWGDLYALKVRYHHDGSEVLHDNILFEATDGTNSAEFVL
QVKVLPVNDEPPVLKADLIPIIHCLEGEEVVITSEHVYATDMDSDDTKLMFMITRQPHHG
VVKKSGIAVDQFTQGDIDAGTVTYKHTGGEIGMTPCFDTVTLVVLDGEAGPRDCCYQEPI
SSLLPLHHSFPVFDLNVTVHPVDNQPPTITTGTQFVVDEGSSAAITVNHLITADPDTAMD
DLEFALVSPPQFGYIENILPSPGFEKSNIGISIASFRWKDMKALHINYVQSRHLRIEPTA
DQFMIYVTDGKQHSLEIPFHVLINPTNDEVPDFVAENITVSEGQTKEVDLSVIQATDLDI
PKDHLMFTITRKPQHGLLINGVHRNDIPLYKQLINIHKNHELPVHDFSMELLKTGMKLMY
IHDDSESLADDFTIQLSDGKHKILRTISIKILPVNDEKPVLTKKAEIELNMGEIRIISSA
VLSATDKDTPREKIFYLFERLPENGQLQLKIGRNWVPLQPGMKCTQEEVDLNCVRYIHTG
AMGSQNQDSFTFHLWDGDNRSPTLDCHISIKDIEKDIVVFTKPLAMSKGDRGFLTTSTLL
ATDGTDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXFVVSNGLRTKHGVFEITLETIDQALPVVTRNKGLRIMENSTVLLSPDILQLSDPDTP
TANLTFLLSQLPQYGQLYLRGMVLTQYNFTQQEVDNMSVAYRHLGGNSQIDWFTFMATDR
TNRGFVVDGRVLNEPVSFTIQVDQLDKKAPRIIHLKYPSHVELLKNGCYGIYITSRVLKA
SDPDTEDNQIIFKILRGPQYGHLENTTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXLELKWSHIQLLQTEYEVCETVNTLPLKITRTGHSMESAFVGVK
VNQVSATIGKDFTVNPSKLIQFDPGMSTKMWNIAITYDGLEEEDEVFEVILNSPVNTVLG
TKTKARVKILDSKGGRCHHSHSSGQNQYNSQGKGMWFPLSPSSSSPSIPDGIHLEGRHLS
SSKSSKDRITPSSGDKLRDFDLTDIPRKRLQTIENGKTVHPSSVYRNGTDTIFRYHGMVA
LRVEDERSTINMEKPRVSVINQRPQKKSRKMEPLQADKMERMPYLHSPSQDQSPSFSKNC
TLELKGLFHFEESLQKLYHCNGISWKPWSPKDKEVNERTCPTGWSHQNSHCYSLITEQEV
TWNAAARACREQHQGNLASVFTKQHMQWLWDFSGRKSFWIGLNDQENAGHWEWDGGEPVT
FTNWRRGAPSHLKKRKNCVLVKRRGKWQAKDCRKGKAHNYVCAKKL
Download sequence
Identical sequences ENSMEUP00000011294 ENSMEUP00000011294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]