SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011333 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011333
Domain Number 1 Region: 393-506
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-28
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000393
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 200-257
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000386
Family PDZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011333   Gene: ENSMEUG00000012403   Transcript: ENSMEUT00000012468
Sequence length 713
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5257:13420:32452:1 gene:ENSMEUG00000012403 transcript:ENSMEUT00000012468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVSSWGPGSVVAWLRGLDDLVQEYPFEEWALVGSDLLQLSPQSLEALGVWHIGHQELI
LDGVEQLRTLSSGLETENLRKLTEQLQTLTHKLCSLVPGCLGASGEPAPDLLTGAIELVR
AAWALLCWLNRYLFSQINDFSACEIGDLCRELAQALQEDYPVAKKEAKILRLGDNILSIC
DAILNFSPTDLLDQLAVLELVELRGRHPEEPLGLEILTTSSCHHFVSATAPESPADCCSQ
ILLGDEIVQVNGQVVVSPPEGKMVGWPRASLNRQLLQDPALLRLVLKTVPVPKSAPQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVATRLSRRRVSCRELGRPDCDGWLLLRKV
PASFMGPRWRRCWMVLKGHNLYWYRQPQDEKAEGLINVSNYSLESGRDQKKKYVFQLTHD
IYKPFIFAADTLDDLSRWVSHLVTCISKYQSHSRTAAPREEDCYSETEAEDPDEEVGSRS
TSPSPVGVWSSLPGDASPSATTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSLLGRP
QFLTQEQCRRSFLRRARDPQLNERAHHVRCLQSTLKAKLQELQVLDEVLNDPMLTSEKFQ
RWKEKNQELYSEGLGAGLGQAEGTSCLPTLEPGYASDSKEHCLLTSCPRPPDL
Download sequence
Identical sequences ENSMEUP00000011333 ENSMEUP00000011333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]