SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011380 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011380
Domain Number 1 Region: 10-301
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.59e-54
Family BAR domain 0.000000519
Further Details:      
 
Domain Number 2 Region: 277-348
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000226
Family Pleckstrin-homology domain (PH domain) 0.0000607
Further Details:      
 
Domain Number 3 Region: 543-613
Classification Level Classification E-value
Superfamily PH domain-like 0.00000229
Family Phosphotyrosine-binding domain (PTB) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011380   Gene: ENSMEUG00000012477   Transcript: ENSMEUT00000012519
Sequence length 661
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4560:698:72124:-1 gene:ENSMEUG00000012477 transcript:ENSMEUT00000012519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVDKLLLEEALDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQL
SKQLLAYEKQNFALGKGDEEVITTLHYFSKVVDELNLLHTELTKQLADTMVLPXXXXXXX
XXXXVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVKSEVAKEVATARRKQHLSSLQY
YCALNALQYRKRVAMMEPMLGYAQGQINFFKKGAEMFSKRMDNFLSTTRTMVQSIQEESE
AEVEKMRLSQQELLSVDESVYTPDFDVAAPAINRNLIQKAGYLNLRNKTGLVTTTWERLY
FFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPTGKPXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAVAIKLNQTALQAVTPITSFGKKQEPSRSSQNRKHSG
LENDKVVPNTSAKVPDADQLIVPGTPIQFDIVLPATEFLDQNRSGRRTNPFGESADEKQP
NEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXLIDPQTQVTRASFELTSVTQFAAHQENKRLVGFVVHVPESDGEESLSTYVFESNTEGE
KICYAISLGKEIIEAQKDPEALAQLMLSMPLTNDGKFVLLNDQPDSEEGNPNENTGAESE
A
Download sequence
Identical sequences ENSMEUP00000011380 ENSMEUP00000011380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]