SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011422 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000011422
Domain Number - Region: 152-182
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00104
Family C-type lectin domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011422   Gene: ENSMEUG00000012535   Transcript: ENSMEUT00000012562
Sequence length 183
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8912:6700:60823:1 gene:ENSMEUG00000012535 transcript:ENSMEUT00000012562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MXARLGRHTLTLLVLFLFQIQILCLNVDSRPPPDICSTHTVLPGPKGDDGEKGEKGEEGK
HGKVGPMGPKGVKGELGEVGDQGILGKIGPIGEKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXIWIKETDEKFYYIVQEEKSYRESLTHCRIRGGMLA
MPK
Download sequence
Identical sequences ENSMEUP00000011422 ENSMEUP00000011422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]