SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011483 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011483
Domain Number 1 Region: 101-161
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000528
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000132
Family Link domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011483   Gene: ENSMEUG00000012603   Transcript: ENSMEUT00000012631
Sequence length 588
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8190:13036:47125:-1 gene:ENSMEUG00000012603 transcript:ENSMEUT00000012631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLFVLESWNGSQGLDLSVARASCVASGAHLATAAELRRAVLECSFATCTTGWLADGTIGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPCGDPPSFPHTILHGHTGFE
MGDELLYVCAQGYVMGHKETAFTLLCDSCGEWYGLVQACVKDETETHIDYEENFPDDRST
PLTDHKKDQSREEEKEARDQEEASDKLKQGYSISVSLERESMLGNKDIKTRDLPGGEGRA
PTESPVSLLSQKHLFWFPAEGFHEPELEKEMIEENAQRRFSDGDNHIGVKSRLHEPGSKM
IYDSADFPIGPTLGRNDSKVGEHMASSSDESWLDGYPVTDGTREEEEDDEGDKGDGSVGL
DESILVMTDQPNHVEVKKSSSTMFTIGEDVTQLTVTLMRTLDYGPVTFTPTAAPENVSPS
KGVSDMVTYQSTVPWGFATDESPMSTLLYDLTNSTPGTMTSRSQPLDYIPSPMLATTLPP
IQTTMLSTRSSFPDSPSERFMEQELPTSGIKEEPLPTTESCVGEDCSSVSKGPVIAVIVI
VLCLLLLLVVISAVWCYRRRQQKSSVYKLNGKGQTRHYHQQIEMQKVL
Download sequence
Identical sequences ENSMEUP00000011483 ENSMEUP00000011483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]