SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011526 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011526
Domain Number 1 Region: 356-598
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.66e-53
Family Mammalian PLC 0.00000227
Further Details:      
 
Domain Number 2 Region: 200-275
Classification Level Classification E-value
Superfamily EF-hand 1.86e-23
Family EF-hand modules in multidomain proteins 0.00063
Further Details:      
 
Domain Number 3 Region: 1-112
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-17
Family Pleckstrin-homology domain (PH domain) 0.00065
Further Details:      
 
Domain Number 4 Region: 1080-1139
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.000000000445
Family C-terminal domain of PLC-beta 0.0033
Further Details:      
 
Domain Number 5 Region: 968-1005
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.000000549
Family C-terminal domain of PLC-beta 0.0096
Further Details:      
 
Domain Number 6 Region: 699-763
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000294
Family PLC-like (P variant) 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000011526
Domain Number - Region: 114-165
Classification Level Classification E-value
Superfamily EF-hand 0.000136
Family EF-hand modules in multidomain proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011526   Gene: ENSMEUG00000012627   Transcript: ENSMEUT00000012678
Sequence length 1185
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8747:5553:165171:1 gene:ENSMEUG00000012627 transcript:ENSMEUT00000012678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSTIVTPIILRTDPQGFFFYWTDQNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVG
NIGRLEHRMITVVYGPDLVNISYLNLVAFQEEVAKEWTDEVFSLATNLLAQNMSRDAFLE
KAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXGAKSRPYLTVDQMMEFINLKQRDPRLNEILYPPLKQEQVQV
LIEKYEPNNSLAKKGQISVDGFMRYLSGEENGVVXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVIE
AIAECAFKTSPYPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLP
SPMDLMYKILVKNKKKSHKSSEGSAKKKLSEQASNTYSDSSSVFEPSSPGAGEADIESDD
DDDDDDDCKKSSMDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXYNKMQLSRIYPKGTRVDSSNYMPQVFWNAGCQMVALNFQTVXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEEPIVFKKVVLPSLACLRIAAYEE
GGKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSN
PIRYVNLMEQRAKQLAALTLEDEEEVKKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXSVKAPAKTEDLIQSVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEPSSPDHGSSTMEQ
DLAALDAEMTQKLVELKDKQQQQLLNLRQEQYYSEKYQKREHIKLXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LEDAQSKRQEKLLEKHKEIRQQILDEKPKMQVELDQEYQDKFKRLPLEILEFVQEAMKGK
ISEDGNHSSISSSLTSDSSKVNHKSPPNEEELEEDNAERVFDTPL
Download sequence
Identical sequences ENSMEUP00000011526 ENSMEUP00000011526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]