SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011643 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011643
Domain Number 1 Region: 684-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.95e-37
Family Protein kinases, catalytic subunit 0.0000176
Further Details:      
 
Domain Number 2 Region: 1-160
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.73e-29
Family FCH domain 0.0048
Further Details:      
 
Domain Number 3 Region: 452-550
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-29
Family SH2 domain 0.00048
Further Details:      
 
Domain Number 4 Region: 222-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000575
Family FCH domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011643   Gene: ENSMEUG00000012763   Transcript: ENSMEUT00000012805
Sequence length 822
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5931:89:102904:1 gene:ENSMEUG00000012763 transcript:ENSMEUT00000012805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGSDLKNSHDALLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQIDKESTAH
MNYVSNVSQTWLLMIQQTEQLSKIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQ
IEADMFKVTKTELEKLKTSYRQLIKEMNYAKEKYKEALAKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSIFDEYSQITSLVTEEI
VNVHKEIQTSVEQIDPSTEYNNFIDVYRSPAVEEQEIEFDASLLEENESLQANEIMWNNL
TAESLQIMLKTVEEELMQTQQMLLNKEEVVLELEKSIEESSKTCEKKSDVVLLLSQKQSL
EELKQSVQQLRCAESKFIAQKELLEQKVQENDGKEPPPVFNYEEDARSVTSMXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXFCDVISASDKPLVEQDWYHGAIPRIEAQELLKQQGDF
LVRESHGKPGEYVLSVFSDGQRRHFIIQFADNLYRFEGTGFTNIPQLIDYHYTTKQVITK
KSGVVLLNPVVKDKKWVLSHEDVTLGELLGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXDLAARNCLVGENNILKISDFGMSRQEDGGIYSSSGLK
QIPIKWTAPEALNYGRYSSESDAWSFGILLWETFSLGVCPYPGMTNQHAREQVEQGYRMS
APQKCPEEIYKIMLRCWDYRPENRPKFSELQKELAAIKKKVT
Download sequence
Identical sequences ENSMEUP00000011643 ENSMEUP00000011643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]