SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011677 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000011677
Domain Number - Region: 57-111
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0889
Family IMD domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011677   Gene: ENSMEUG00000012804   Transcript: ENSMEUT00000012841
Sequence length 217
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6633:47725:73790:1 gene:ENSMEUG00000012804 transcript:ENSMEUT00000012841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANASGSNGGGSSGEVGGGEDSSLADGSATAHVPKVKLLDTVVDTFLQKLVSAGSYERFA
RCYKRFYKLQPEMTRLIYDQFITQLQTSIREEISTIKEEGNLEAVLNSLDKIVEEAEDRK
EPACSSHPSDWSRTRRRRMSNWLKWSWKGGSRCWSYSNRSRPGSKLGXXXXXXXXXXXXX
XLCLQAEQAGEETQALPVQHTRVSCSIPPLGAETGGV
Download sequence
Identical sequences ENSMEUP00000011677 ENSMEUP00000011677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]