SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011767 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011767
Domain Number 1 Region: 282-502,559-607
Classification Level Classification E-value
Superfamily Kelch motif 1.12e-27
Family Kelch motif 0.013
Further Details:      
 
Domain Number 2 Region: 697-778
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000612
Family C-type lectin domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011767   Gene: ENSMEUG00000012879   Transcript: ENSMEUT00000012940
Sequence length 1328
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2274:5459:229188:1 gene:ENSMEUG00000012879 transcript:ENSMEUT00000012940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERARQPAAPALGRARTGGGGGASSWLLDVPSWLLGYGFLYLVLYAQVFQSKTCDRNASC
YSGRCVNATCLCDQGWVGDHCQHCQGRFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXINSCPNNCSGHGKCTNSASIPSRVYCECDKYWKGEACDIPYC
KANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESFWILPNVKPFSPSVGRASHK
AVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVAPVSRGPLQRYGHSLALYQENIFM
YGGKIETNNGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIMELDSRDVVMI
IIFGYSAVYGYTSSIQEYHILSNTWLVPETKGAIVQGGYGHTSVYDEMTKSIYVHGGYKA
LPGNKYGLVDDLYKYEVNTKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXCDEWKILPKPNLHRDVNRGHSAVVVNGSMYIFGGFSSVLLNDILVY
KPPNCKAFRDEELCKNAGPGIKCLWNKNHCESWEGEHNNILRAKCSTKTXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVKNFTKCHVKNEQICNKLTSCKSCSLNLNC
QWDQRQQECQALPAHLCGEGWNHIGDACLRINSSKENYDNAKLYCYSLAGNLASLTSSXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSPNQNARPCKKPCSLRTTCSNCTSNGMEGMWCSS
TKRCVDSNAYIIFFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTGKGH
CIEGSSRGPMKLVGMHTSEMTLDTSLCPREKNYEWSFIYCPXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXCTCSGHANICHMHTGKCFCTTKGIKGDQCQLC
DSENRYVGNPLRGTCYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGTISGEEILLIYRVRIKEFRDSFSCEKFNFRGNPNITFYVYVSNF
SWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWASRRREQLLRER
QQMASRPFASVDVAVEVGAEQTDFLRGTLEGAPKPIAIEPCAGNKAAVLTVFLCLPRGPS
GIPPPGQS
Download sequence
Identical sequences ENSMEUP00000011767 ENSMEUP00000011767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]