SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011839 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011839
Domain Number 1 Region: 1512-1624
Classification Level Classification E-value
Superfamily C-type lectin-like 2.31e-46
Family Noncollagenous (NC1) domain of collagen IV 0.00000182
Further Details:      
 
Domain Number 2 Region: 1400-1509
Classification Level Classification E-value
Superfamily C-type lectin-like 4e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011839   Gene: ENSMEUG00000012946   Transcript: ENSMEUT00000013022
Sequence length 1625
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9264:54330:176890:1 gene:ENSMEUG00000012946 transcript:ENSMEUT00000013022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACHGCSSGLKCDCSGIKGEKGERGLPGLEGHPGLPGFPGAEGPPGPPGQKGDDGAPGPVG
PKGIRGPPGLPGFPGTPGLPGMPGHEGAPGPQGIPGCNGTKGERGFPGISGVPGLPGPPX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPPG
PPGIQGPKGNMGLNFQGPKGEKGEQGLQGPPGPPGQIGELKGSNETELLKGDQGAPGDRG
SPGLPGLQGPPGLPGGVKGEKGQQGEPGQKGKPGRDGASGLPGIQVIPCRGTGEKGNLGL
PGLPGEKGEQGFPGVPGPPGLPGPPGTAVTGPPGPPGFPGERGEKGAQGLPGITIPGQPG
LDGWPGAPGLPGTPGQPGPHFPSNGEMCEKGARGPPGSPGERGRPGEQGVKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXARGFPGQKGVKGNVGATGPVGSPGLPGAPGTSGLPGS
KGSPGDTLTFPEMKGDKGDAGFPGAPGIPGLPGTPGQDGLPGLPGIKGKPGGFALKGKRG
VPGKPGLPGLPGSRGPMGPPGLGPPGPMGEKGIQGLAGNPGPPGVPGAKGDPGPAISQPG
PPGLPGLPGTDGDVGLPGDPGLPGVQGLPGIPGSKGEPGSPGTGLPGPPGLKGYQGMLGP
PGTPGAPGRRGLQGPPGNPGFPGPKGEPGVGLPGPPGLKGPPGLKGTPGPKGNTGFPGPP
GMPGLPGLDGLPGSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPGAPG
GKGEPGPPGFDVSGPPGERGHRGIPGTPGVMGPQGSPGPPGRDGAPGLSGAKGEMGKLGP
PGPPGPLGIPGRNGVPGLKGEDGLPGQAGFPGPVGQKGGKGEPGIPGPPGQVDPNCLTVK
GEKGEPGLPGIPGVLGPKGSQGIPGDPGQPGLVGQPGSPGPPGPKGNQGLPGQPGVVGPR
GLKGRVGEMGFPGLQVQGSPGLPGVAGQPGSPGFLANGEKGAPGVVEIAVPGPGPXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGLPGPRGLDGPPGSPGIPG
QPGPVGSQGHPGPPGSPGEKGKPGQDGIPGPAGQKGEPGQPAFGFPGPPGIPGFPGEKGD
VGSPGTPGKPGPQGSKGEQGFPGFPGIQGPPGPPGFPGQNREGPKGNPGPRGRPGRPGPE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDPGRTGLIGMK
GNTGVQGIPGFQGMKGHAGASGSAGPVGDPGPRGPSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRGVDGV
PGPDGLPGLPGPPGTLSLAHGFLITRHSQTTDIPQCPRGTVQIYRGFSLLYVQGNEKAHG
QDLGTSGSCLHRFSTMPFMFCNINNICNFASRNDYSYWLSTPKPMPVTMEPLKGQSILPF
ISRCSVCEVPATVIAIHSQTTQIPHCPQGWDSLWIGYSFMMHMSAGAEGSGQALASPGSC
LEEFRSAPFIECHGRGTCNYYANSYSFWLATVEAPDMFSKPQPETLKTGDLRTRISRCQV
CMKRP
Download sequence
Identical sequences ENSMEUP00000011839 ENSMEUP00000011839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]