SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011855 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011855
Domain Number 1 Region: 3-203,230-236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.34e-44
Family BAR domain 0.000017
Further Details:      
 
Domain Number 2 Region: 305-363
Classification Level Classification E-value
Superfamily SH3-domain 0.0000715
Family SH3-domain 0.0000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011855   Gene: ENSMEUG00000012997   Transcript: ENSMEUT00000013040
Sequence length 368
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4645:7403:23345:-1 gene:ENSMEUG00000012997 transcript:ENSMEUT00000013040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLQKLGKADETKDEQFEQCVQNFNKQLTEGSRLQKDLCTYFASVKAKHEASKKLTECLQE
VYEPDWPGREETNKIANSDLLWMDYHHKLVEQVLLTMDTLGKLPDIKSRTAKRGRKLVDY
DSARHYYESPQTAIKKDEAKTEEELIKVQKVFEEMNVDLQEEVPSLWNSRVGFYVNTFQS
IAGLEENFHKEMSKLNQNLNDVLVNLEKQHGSNTFTVKAQPSDNAPMKGNKSPSPPPDSS
LAGTPEIKVNHEPETPGTFIPKSPSQSSLPAVVMETFPATINGIVEGSAPSRSDLLPGFL
FKVQTHDYTATDSDELLKVGDVVLVIPFENPEEQDEGLMGVKESDWHQYNALEKCRGVFL
ENFREKIQ
Download sequence
Identical sequences ENSMEUP00000011855 ENSMEUP00000011855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]