SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012261 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012261
Domain Number 1 Region: 1-247
Classification Level Classification E-value
Superfamily C-type lectin-like 3.39e-70
Family Sulfatase-modifying factor-like 0.0000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012261   Gene: ENSMEUG00000013444   Transcript: ENSMEUT00000013483
Sequence length 248
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5439:532:38380:-1 gene:ENSMEUG00000013444 transcript:ENSMEUT00000013483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHIPAGVFTMGTDDPQIKQDGEGPARRVRINSFYMDLYEVSNAEFEKFVNSTGYVTEAE
KFGDSFVFDSMLSDQVKKDIHQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDHPVLHVS
WNDAVAYCTWAGKRLPTEAEWEYSCRGGLENRLYPWGNKLQPKGQHYXXXXXXXXXXXXX
XXXXXXXXXXVTAFPPNGYGLYNIVGNAWEWTSDWWSVHHSADETLDPKGPPSGSDRVKK
GGSYMCHK
Download sequence
Identical sequences ENSMEUP00000012261 ENSMEUP00000012261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]