SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012453 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012453
Domain Number 1 Region: 265-403
Classification Level Classification E-value
Superfamily PH domain-like 7.93e-31
Family Phosphotyrosine-binding domain (PTB) 0.00012
Further Details:      
 
Domain Number 2 Region: 95-245
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-28
Family Phosphotyrosine-binding domain (PTB) 0.019
Further Details:      
 
Domain Number 3 Region: 14-38
Classification Level Classification E-value
Superfamily WW domain 0.00000000131
Family WW domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012453   Gene: ENSMEUG00000013649   Transcript: ENSMEUT00000013691
Sequence length 478
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7880:117901:123516:-1 gene:ENSMEUG00000013649 transcript:ENSMEUT00000013691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLWGDQSLEGEPGLPPGWRKIHDAAGTYYWHVSSGSTQWQRPVWEPGDSIPPDSGTEGAW
GLRPPKGRSFSSLESSLDRRISLPWYGEEAYIRNVEPGSKCFAVRSLGWVEVPEEDLAPG
KSSIAVNNCIQQLAQSRGQNHPPTRAWGEGQNMLMILKKDMMSLVNPLDHSLIHCQPLVH
IRVWGVGSTNGRDRPIPTPHRDFAFVAGDKDTCMLKCHVFRCDVPAKAIASALHGLCAQI
LSERAGVSGEPPRCSLDPISPEDLPRQVELLDAVSQAAQQYEALYVGTLPVSKAMGMDVL
NEAIGALTSQGDHHSWAPTILSVSDSLMTALPVQAKLGAEEEPLWQCPVRHVTFIGVGHD
PHTFGLIADLGHQRFQCAAFWCQPHAGALSEAVQAACMVQYQKCLVASAARGKARGAQAR
ARLRLKRTSSVDSAGGPLPLPLPLLKGGVGGAGAAPRKRGVFSFFDSFRLKPSLLHMP
Download sequence
Identical sequences ENSMEUP00000012453 ENSMEUP00000012453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]