SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012553 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012553
Domain Number 1 Region: 6-132
Classification Level Classification E-value
Superfamily C-type lectin-like 9.1e-34
Family C-type lectin domain 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012553   Gene: ENSMEUG00000013759   Transcript: ENSMEUT00000013798
Sequence length 134
Comment pep:novel scaffold:Meug_1.0:Scaffold54950:8344:10331:1 gene:ENSMEUG00000013759 transcript:ENSMEUT00000013798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSQMDTPPHISCPEGSKAYGSFCYYSSPKTWSSAELNCQSLTSGHLLSLMNESEAAFVAA
LVKENRSHLWIGLHDNRRWRWSDNAMLTFNAWEKGAPAKTTLKFCASLSPSSGFLQWKDQ
HCHEELPFICKFSA
Download sequence
Identical sequences ENSMEUP00000012553 ENSMEUP00000012553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]