SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012771 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012771
Domain Number 1 Region: 920-1031
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00036
Further Details:      
 
Domain Number 2 Region: 397-561
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.55e-26
Family G proteins 0.0000000748
Further Details:      
 
Domain Number 3 Region: 1044-1135
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000275
Family Ankyrin repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 664-726,860-903
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000128
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012771   Gene: ENSMEUG00000013996   Transcript: ENSMEUT00000014042
Sequence length 1166
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4482:3973:15542:-1 gene:ENSMEUG00000013996 transcript:ENSMEUT00000014042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSGAGADVRAPEGGEPGSPRGADEAGK
KRQERLFHRQDALWISTSSAGAGTETLSLSPAPASPACPVSPAPGRRLSLWAAPPVPPLS
GGLSPDPKAGGGSASSRRPLLSSPSWGGPEPESRGWGGVPGSSSPHPGTGNRRLKVAPPL
PAPKPCKTVTTSGGKAGGGKTAGSRLSWPESEGKPRVKGSKSSTGAAAPAGVGTGVGAGA
AAGQGAGARGKLSPRKGKSKTLDNSDLHPGQPAGSPPPQAAPATPAASPAASATSPGLPP
GPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPPGPGPSPGPPGLTS
SSGSRELLAVELRASPXXXXXXXXXXXXXXXXXXXXGVLGDARSGKSSLIHRFLTGSYQV
LEKTESEQHKKEMLVDGQSHLLLIREEAETPDAKFSGWADAVIFVFSLEDENSFQAVSRL
HGQLNTLRGDSRGGLALALVGTQDRISASSPRVVGDARARALCAEMKRCSYYETCATYGL
NVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLP
SSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETAGSG
RAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTV
KVPGKRPPRAISAFGPSASINGLVKDMSTVQMAEGTADIPTPTPTPSPSSLQPPQDQTSK
HLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTEGSAGQAEAK
RKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAGSFEERDSWVQAIESQILASLQ
CCESSKVKLRTDSQSEAVAIQAIRNAKGNSLCVDCGAPNPTWASLNLGALICIECSGIHR
NLGTHLSRVRSLDLDDWPRELTLVLTAIGNETANLIWESDTRGRAKPTRESSREERESWI
RAKYEQLLFLAPLGGPEESLGRRLWAAVQAQDVAGVLLLLAHARHGPLDSDVGDPQLRSP
LHLAAELAHVVITQLLVWYGADVSARDAQGRTALFYARRAGSQLCADILLQHGCPGEGGS
GATTPSPSRRSSAASVGRADAPVALV
Download sequence
Identical sequences ENSMEUP00000012771 ENSMEUP00000012771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]