SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012833 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000012833
Domain Number - Region: 492-613
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00659
Family FCH domain 0.016
Further Details:      
 
Domain Number - Region: 280-414
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.034
Family HBL-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012833   Gene: ENSMEUG00000014060   Transcript: ENSMEUT00000014115
Sequence length 718
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9651:16914:23043:-1 gene:ENSMEUG00000014060 transcript:ENSMEUT00000014115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDKAELCGSLLTWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRRYYFL
SEEPEEADQLRQRCHDLEQQLTLLVEEKQSLVQENRALRDRGAQLEGPEAAGLTSKRLLL
LQSQLEQLQEENFRLESLKEDERLRCVELEREVAELQQRNQALTSLAQEAQTLKDEMDEL
RQSSERASRLEATLSGCQRRLGELGELRRQVRLLEERNAGHAERTRQLEDELRRAGTLRA
QLEGHRRQVQELQSQRQEEALKAEKWLFECRTLEEKYEAVVKEKERLIEERDSLREAHEE
LCCVQVQQRGLSQAGVQLQQMSSPVENLAAEILPAELRETILRLQRENRRLCQQEAADRG
RTEELQGQLEEANRARHRLETQHRLNQQQLAELRAQVEELQKALQEQGGKAEDAISSLLK
RKLEEHLEKLHEAHSELQRKREYIDELQPPADSSAARRIEELQRSLQKKEADMRAMEERY
RRYMEKARTVIQTLEPKQRPPGPPPLEIQALRTQLHEKDLRIRHLETDFEKSRSQREQEE
KLIISAWYNMGMALQQRATGEDRPAYAQSFLAQQRLATNTRRGPLARAQLALRSGDKH
Download sequence
Identical sequences ENSMEUP00000012833 ENSMEUP00000012833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]