SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012988 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012988
Domain Number 1 Region: 1525-1638
Classification Level Classification E-value
Superfamily C-type lectin-like 1.44e-45
Family Noncollagenous (NC1) domain of collagen IV 0.000000513
Further Details:      
 
Domain Number 2 Region: 1418-1524
Classification Level Classification E-value
Superfamily C-type lectin-like 1.77e-42
Family Noncollagenous (NC1) domain of collagen IV 0.000000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012988   Gene: ENSMEUG00000014183   Transcript: ENSMEUT00000014276
Sequence length 1639
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4411:3461:104700:1 gene:ENSMEUG00000014183 transcript:ENSMEUT00000014276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQPGPVGPQGYSGPPGLQGIPGLQGRKGDKGERGAPGITGPKGDVGQRGVSGFPGADGIP
GHPGQGGPRGRPGSDGCNGTTGDAGTQGPPGSGGLPGLPGPQGPKGQKGEPYAFSQAERD
RYRGESGEPGFIGLPGPPGYPGSPGKIGPVGAPGRPGPPGPPGPKGQQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTSAKGEEGIVGY
PGQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIGDRGPPGAPSYSPHPSLIKX
XXGDPGDSGARGPDGSPGEPGDPGLPGPRGTSEGDGVERRGLPGEMGAKGFIGDPGYPAL
YPGPPGTDGKPGLPGPPGPAGPPGPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDP
GDCKCDIPSGLPGPPGPPGRPGANGEPGRKGEIGDPGPHGIPGFSGFKGNPGIPGLPGPK
GQKGDSREITTKGSRGDQGNPGIPGLQGEDGFPGQDGLDGFPGLPGLPDPGFPGVPGLKG
IPGESGPPGLGLPGPKGERGFPGDPGLSGSPGFPGPPGPPGAPGQTXXXXXXXXXXXXXX
XXXXXXXCVIAPKGSPGLPGLPGSPGAKGQRGIPGFPGADGFAGLKGFQGEAGREGFPGP
PGFVGPRGSKGATGLPGLDGNPGSTGLPGAVGPAGQKGLPXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLPAKEGDRGDVGVPVPVGMKGLGGDRGDTGFIGEQGRRGDPGLQGMPGMP
GIPGQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRGEP
GPPGEPPKFLPGMIDFKGEKGDEGPVGGKGYWGTKGGQGMPGIPGQAGIPGLPGIPGYIK
GAKGEIGVPGVPGLQGFPGITGSPGIRGFPGFVGVRXXXXXXXXXXXXXXXXXXXXXXDE
GDTINLPGRPGLKGELGISGLAGEKGFAGEKGTPGDRGFVGLMGIKGXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
DGYGNPGFPGPFGDKGERGEPNIIPGPLGAPGQKGERGNLGQPGPSGSPGIEGLPGFTAP
SNISGLPGDKGAPGLFGIQGYRGPPGAPGPSSSPGIKGDAGSPGLTGERGPKGWPGDPGP
QGRPGVYGLPGEKGPKGQQGLMGYHGIPGNIGDRGPKGPKGDRGLPGPPGAIGSPGIPGI
PLKIATEPGVAGPQGRRGPIGMQGEMGPQGPPGDPGLRGLPGNPGPQGRGGISALPGFRG
DQGPTGLQGPVGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQEPMCPVGMNKLWS
GYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDICHYASRNDKSYWLSTTAPL
PMMPVAEEEIKPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGD
EGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIPEQNFQASPSADTL
KAGLIRTHISRCQVCMKNL
Download sequence
Identical sequences ENSMEUP00000012988 ENSMEUP00000012988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]