SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013155 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013155
Domain Number 1 Region: 1555-1641
Classification Level Classification E-value
Superfamily C-type lectin-like 1.18e-36
Family Noncollagenous (NC1) domain of collagen IV 0.00000396
Further Details:      
 
Domain Number 2 Region: 1487-1552
Classification Level Classification E-value
Superfamily C-type lectin-like 7.06e-24
Family Noncollagenous (NC1) domain of collagen IV 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013155   Gene: ENSMEUG00000014362   Transcript: ENSMEUT00000014459
Sequence length 1641
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9204:14339:128054:-1 gene:ENSMEUG00000014362 transcript:ENSMEUT00000014459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRPVVWLLLLAALLLNEERSRAAAKGCSGSGCGKCDCHGVKGQKGERGLPGLQGVIGF
PGMQGPEGPHGPPGYKGDAGEPGLPGTKGTRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXGDRGPVGPPGLPGFSGIAGPPGLPGMKGDPGEILSLIPGMPLKGERGFPGPPG
PMXXXXXXXXXXXXXXXXXXXXXGPPGPPGLPGEKGQMGLSFQGPKGDKGEQGVSGPPGE
PGQAHMGKKGDFATQGPKGEKGEPGSPGLPGDGEKGEPGKPGPRGKSGKDGEKGEKGSPG
FRGEPGFPGLPGREGAKXXXXXXXXXXXXXXVISTQPGGEKGEKGYPGAPGLKGEPGQKX
XXXXXXXXXXXXFPGTGQIGAPGFPGERGEKGDRGPPGQSLPGTSGRDGFPGPPGLPGPP
GLPGHTNGIVECQPGPPGDQGPPGNVGLPGLTGEMGEKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXFPGQPGAKGDRGLPGHNGLEGMPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDGLPGAVGQPGNPGRPGFDGLP
GNPGVPGQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPGIKGEKGYPGFPGSDMPGPK
GDKGSPGLPGLTGQIGLPGPPGTQGTPGLPGFPGPKGEMGVMGTPGQPGPPGPAGTPGFQ
GVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTGP
IGDKGARGDPGTPGVPGKDGQAGXXXXXXPKGDQGLGGSPGAPGLPGPKGSVGGMGLPGS
PGEKGAQGIPGSQGIPGFPGLKGEKGVKGEAGRPGIGTPGLPGEKGDPGPSGFPGRPGEK
GEKGSPGMPGMPGPPGPGGLPGNVGYPGNPGIPGEKGDKGLPGLDGVPGVKGDAGQPGLP
GPAGPGGQKGEPGGDGIPGSAGEKGEPGLPGRGLPGFPGSKGEKGSKGELGFPGSAGSPG
IPGPKGEPGFMGPPGPPGQQGLPGVPGRAVEGPKGDRGPQGQPGIPGVPGPMGPPGLPGL
DGAKGEKGNPGWPGSPGAPGAKGDPGFQGMPGIGGTPGITGSKGDMGPPGLPGFQGVKGS
PGLQGLKGDQGDQGFPGSKGLPGMPGAPGPYSLIKGEPGIPGPEGPAGLKGLPGPPGPKG
QQGVTGSAGIPGPPGNPGFDGAPGQKGEPGPFGPPXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAGSCLRKFSTMP
FLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVH
SQTIQIPQCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGT
CNYYANAYSFWLATIERNEMF
Download sequence
Identical sequences ENSMEUP00000013155 ENSMEUP00000013155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]