SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013160 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013160
Domain Number 1 Region: 173-283
Classification Level Classification E-value
Superfamily PH domain-like 4.43e-32
Family Phosphotyrosine-binding domain (PTB) 0.00045
Further Details:      
 
Domain Number 2 Region: 34-166
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000067
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013160   Gene: ENSMEUG00000014409   Transcript: ENSMEUT00000014464
Sequence length 463
Comment pep:novel scaffold:Meug_1.0:Scaffold16724:25767:30320:1 gene:ENSMEUG00000014409 transcript:ENSMEUT00000014464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSVGGKGSSKKGKPSPFASGLLSEHWALASAMDTQETPLKDGLLYQQHVKFGKKSWRKV
WAFLYAEGPSGVARLENWDVRDGGAGPAGDKPTGRRGERRVIRLADCVSVLPADGESCPR
DTSAFLLTTTERSHMLAAQHRHTWMAHICHLAFPSSGTGEFGPSELSLVPMEENSIYSSW
QEIGEFSVLVQKTEAATRCQLKGPYLLVTGQDAIHLSEPTAPQPLYVWPYHFLRKFGYDK
GVFSFEAGRRCDSGEGLFAFSCPRASEICSAVGAAIARQRELLDLSSRLCPLARASSLPS
LEPMTELREAPLGLEPGEVKHLAQLLLEAGPQSLPPCLGTLPPGLPWLASALYASVSKWS
SGPSRTEHLYENLCTLEDGATLQSGEGLLQASHSGHRTHIYDNSECLSWPGPQATMDSTL
EAQYRRLLELDLNEEGEGSPGAHSGFKAKLVTLLSRERKKGPT
Download sequence
Identical sequences ENSMEUP00000013160 ENSMEUP00000013160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]