SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013261 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013261
Domain Number 1 Region: 4-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.21e-68
Family IMD domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013261   Gene: ENSMEUG00000014518   Transcript: ENSMEUT00000014568
Sequence length 716
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6392:72600:94732:-1 gene:ENSMEUG00000014518 transcript:ENSMEUT00000014568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCM
RHRSIETKLRQFTNALLESLINPLQERIEDWKKTANQLDKDHAKEYKRARHEIKKKSSDT
LKLQKKARKELLGKGDLQPQLDNALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITF
LQPVVNGEITMLGEITHLQGIIDDLVVLTAEPHKLPPASEQVIKDLKGSDYSWSYQTPPS
SPSSSGSRKSSMCSPSSGNSTKGGAPWPGGSQTYSPSSTYRYRSLAQPVNTSARLSSVSS
HDSGFISQDAMYSKPPSPMPSDITSQKSSSSASSEASETCQSVSECSSPTSDWSKAGPYD
QPVATTLQRRKDRVEHLREAEVGPGSGSYPSIGGEETPRPRMSPATIAAKHGEEVSPAAS
DLAMVLTRGLSLEHQKSSRDSLQYSSGYSTQTTTPSCSEDTIPSQGSDYDSYSVNGDVEV
EGQSEFDKSSTIPRNSNIAQNYRRMIQTKRPASTAGLPTGMALPSGAPPGVATIRRTPST
KPSVRRTLSNAGPIPIRPPIVPVKTPTVPDSPGYTGPTRVGSEECVFYTDDASSPHAPDF
AKASPKRLSLPNTAWGSTSLEVASYPGAGAEEEQQLAANRHSLVEKIGELVAGAHALGEG
QFPFPTTLSSASGEETPIPPPAASSDPPAEDMLVAIRRGVRLRRTITNDRSAPRIL
Download sequence
Identical sequences ENSMEUP00000013261 ENSMEUP00000013261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]